Mascot Search Results

User            : Skothiya
Email           : S.Kothiya@dundee.ac.uk
Search title    : 
MS data file    : D:\OrbiTrap\November2008\MMuqit 081119 MFP\MMuqit_081119_01.msm
Database        : IPI-human  (73928 sequences; 31129648 residues)
Timestamp       : 10 Dec 2008 at 10:52:02 GMT

Protein hits    : IPI00301263 Tax_Id=9606 Gene_Symbol=CAD CAD protein
  IPI00011654 Tax_Id=9606 Gene_Symbol=TUBB Tubulin beta chain
  IPI00007752 Tax_Id=9606 Gene_Symbol=TUBB2C Tubulin beta-2C chain
  IPI00152453 Tax_Id=9606 Gene_Symbol=TUBB3 HCG2042771
  IPI00644620 Tax_Id=9606 Gene_Symbol=TUBB3 35 kDa protein
  IPI00011569 Tax_Id=9606 Gene_Symbol=ACACA Isoform 1 of Acetyl-CoA carboxylase 1
  IPI00220327 Tax_Id=9606 Gene_Symbol=KRT1 Keratin, type II cytoskeletal 1
  IPI00024067 Tax_Id=9606 Gene_Symbol=CLTC Isoform 1 of Clathrin heavy chain 1
  IPI00029446 Tax_Id=9606 Gene_Symbol=SBF1 Isoform 1 of Myotubularin-related protein 5
  IPI00009865 Tax_Id=9606 Gene_Symbol=KRT10 Keratin, type I cytoskeletal 10
  IPI00293665 Tax_Id=9606 Gene_Symbol=KRT6B Keratin, type II cytoskeletal 6B
  IPI00021304 Tax_Id=9606 Gene_Symbol=KRT2 Keratin, type II cytoskeletal 2 epidermal
  IPI00003421 Tax_Id=9606 Gene_Symbol=TBR1 T-box brain protein 1
  IPI00910412 Tax_Id=9606 Gene_Symbol=- cDNA FLJ60844, highly similar to Homo sapiens centrosomal protein 170 kDa (CEP170), transcript variant alpha, mRNA
  IPI00019502 Tax_Id=9606 Gene_Symbol=MYH9 Isoform 1 of Myosin-9
  IPI00397526 Tax_Id=9606 Gene_Symbol=MYH10 Isoform 1 of Myosin-10
  IPI00014424 Tax_Id=9606 Gene_Symbol=EEF1A2 Elongation factor 1-alpha 2
  IPI00382401 Tax_Id=9606 Gene_Symbol=CENPL cDNA FLJ31786 fis, clone NT2RI2008526
  IPI00642952 Tax_Id=9606 Gene_Symbol=- Hypothetical protein
  IPI00456492 Tax_Id=9606 Gene_Symbol=CROCC Isoform 1 of Rootletin
  IPI00440016 Tax_Id=9606 Gene_Symbol=P2RX6 P2RX6 protein
  IPI00169307 Tax_Id=9606 Gene_Symbol=ARHGAP21 Rho GTPase activating protein 21
  IPI00745955 Tax_Id=9606 Gene_Symbol=EBNA1BP2 EBNA1 binding protein 2
  IPI00790962 Tax_Id=9606 Gene_Symbol=NEU4 sialidase 4
  IPI00218743 Tax_Id=9606 Gene_Symbol=BEST1 Isoform 2 of Bestrophin-1
  IPI00167180 Tax_Id=9606 Gene_Symbol=TTC18 122 kDa protein
  IPI00007675 Tax_Id=9606 Gene_Symbol=DYNC1LI1 Cytoplasmic dynein 1 light intermediate chain 1
  IPI00022881 Tax_Id=9606 Gene_Symbol=CLTCL1 Isoform 1 of Clathrin heavy chain 2
  IPI00168218 Tax_Id=9606 Gene_Symbol=DOK7 Isoform 2 of Protein Dok-7
  IPI00296259 Tax_Id=9606 Gene_Symbol=TMED4 Isoform 1 of Transmembrane emp24 domain-containing protein 4

Probability Based Mowse Score

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 31 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score or expect cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red

        Error tolerant   

1.     IPI00301263    Mass: 245167   Score: 1902   Queries matched: 92   emPAI: 0.51
  Tax_Id=9606 Gene_Symbol=CAD CAD protein
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  280   314.166522   626.318492   626.317627   1.38  0   9   4.1  2    R.AAYFR.Q
294   321.725222   641.435892   641.433670   3.46  1   18   0.27  1    R.RVVLR.G
423   397.723858   793.433164   793.433380   -0.27  0   18   1.4  1    R.LYELTR.I
  633   451.758071   901.501590   901.502136   -0.61  0   (11)  15  9    R.YVAPPSLR.M
  636   452.259620   902.504688   901.502136   1112  0   14   7.1  4    R.YVAPPSLR.M
650   458.783995   915.553438   915.554184   -0.81  0   (31)  0.058  1    R.LGYPVLVR.A
651   458.783995   915.553438   915.554184   -0.81  0   34   0.035  1    R.LGYPVLVR.A
655   459.279666   916.544780   915.554184   1082  0   (15)  2.5  1    R.LGYPVLVR.A
657   459.742792   917.471032   917.471924   -0.97  0   (27)  0.31  1    R.VFNTGGAPR.I
658   460.244818   918.475084   917.471924   1093  0   44   0.0056  1    R.VFNTGGAPR.I
  683   469.276286   936.538020   936.539261   -1.33  1   13   2.9  3    R.RLSSFVTK.G
741   484.252812   966.491072   966.492325   -1.30  0   (41)  0.0069  1    K.VPQFSFSR.L
742   484.252812   966.491072   966.492325   -1.30  0   44   0.0039  1    K.VPQFSFSR.L
761   490.773532   979.532512   979.533829   -1.34  0   49   0.001  1    R.FLSSAAAVSK.E
  774   493.234609   984.454666   984.455246   -0.59  0   (18)  0.72  2    R.SFEEAFQK.A
775   493.234609   984.454666   984.455246   -0.59  0   26   0.12  1    R.SFEEAFQK.A
777   493.317574   984.620596   984.621887   -1.31  1   28   0.063  1    R.KEEILLIK.A
823   510.253376   1018.492200   1018.493073   -0.86  0   48   0.0019  1    R.ELSDLESAR.Q
824   510.253376   1018.492200   1018.493073   -0.86  0   (30)  0.1  1    R.ELSDLESAR.Q
825   510.760157   1019.505762   1019.506989   -1.20  0   55   0.00042  1    K.SVGEVMGIGR.S + Oxidation (M)
826   510.760157   1019.505762   1019.506989   -1.20  0   (48)  0.002  1    K.SVGEVMGIGR.S + Oxidation (M)
827   511.261233   1020.507914   1019.506989   982  0   (52)  0.00088  1    K.SVGEVMGIGR.S + Oxidation (M)
845   515.791937   1029.569322   1029.570587   -1.23  0   77   3e-06  1    R.SILEQLAEK.N
846   516.300070   1030.585588   1029.570587   986  0   (40)  0.013  1    R.SILEQLAEK.N
908   530.812154   1059.609756   1059.611038   -1.21  0   (82)  5.5e-07  1    R.MALLATVLGR.F + Oxidation (M)
909   530.812154   1059.609756   1059.611038   -1.21  0   93   4.7e-08  1    R.MALLATVLGR.F + Oxidation (M)
910   530.812154   1059.609756   1059.611038   -1.21  0   (51)  0.00065  1    R.MALLATVLGR.F + Oxidation (M)
933   536.804302   1071.594052   1071.592407   1.54  0   74   4.6e-06  1    R.LSLDDLLQR.L
934   536.804302   1071.594052   1071.592407   1.54  0   (61)  0.00011  1    R.LSLDDLLQR.L
945   539.781736   1077.548920   1077.550186   -1.17  0   35   0.041  1    R.SVHICHVAR.K
975   550.295862   1098.577172   1098.578156   -0.90  0   33   0.049  1    K.GEVRPELGSR.Q
  976   550.295862   1098.577172   1098.578156   -0.90  0   (16)  2.3  4    K.GEVRPELGSR.Q
992   558.260828   1114.507104   1114.507690   -0.53  0   93   2.3e-08  1    R.TSSSFAAAMAR.L + Oxidation (M)
993   558.260828   1114.507104   1114.507690   -0.53  0   (72)  2.9e-06  1    R.TSSSFAAAMAR.L + Oxidation (M)
994   558.260828   1114.507104   1114.507690   -0.53  0   (77)  8.5e-07  1    R.TSSSFAAAMAR.L + Oxidation (M)
1122   605.801130   1209.587708   1209.587708   0.00  0   33   0.051  1    R.ASDPGLPAEEPK.E
1123   605.801130   1209.587708   1209.587708   0.00  0   (32)  0.062  1    R.ASDPGLPAEEPK.E
  1133   609.335245   1216.655938   1216.656403   -0.38  0   (15)  4  3    R.HPQPGAVELAAK.H
  1134   609.335245   1216.655938   1216.656403   -0.38  0   (9)  15  10    R.HPQPGAVELAAK.H
1135   609.335245   1216.655938   1216.656403   -0.38  0   20   1.2  1    R.HPQPGAVELAAK.H
1146   612.834453   1223.654354   1223.654999   -0.53  0   (33)  0.05  1    K.ATGYPLAYVAAK.L
1147   612.834453   1223.654354   1223.654999   -0.53  0   36   0.023  1    K.ATGYPLAYVAAK.L
1151   614.865614   1227.716676   1227.718689   -1.64  0   86   1.9e-07  1    K.TLGVDLVALATR.V
1152   614.865614   1227.716676   1227.718689   -1.64  0   (84)  3.4e-07  1    K.TLGVDLVALATR.V
1153   614.865614   1227.716676   1227.718689   -1.64  0   (26)  0.22  1    K.TLGVDLVALATR.V
1174   625.379288   1248.744024   1248.744141   -0.09  1   39   0.0033  1    K.KNILLTIGSYK.N
1175   625.379288   1248.744024   1248.744141   -0.09  1   (37)  0.0048  1    K.KNILLTIGSYK.N
1281   456.941437   1367.802483   1367.803757   -0.93  0   (33)  0.022  1    R.LPGLIDVHVHLR.E
1282   456.941437   1367.802483   1367.803757   -0.93  0   (38)  0.0065  1    R.LPGLIDVHVHLR.E
1283   456.941437   1367.802483   1367.803757   -0.93  0   (41)  0.0039  1    R.LPGLIDVHVHLR.E
1284   684.909053   1367.803554   1367.803757   -0.15  0   85   1.5e-07  1    R.LPGLIDVHVHLR.E
1285   684.909053   1367.803554   1367.803757   -0.15  0   (52)  0.00027  1    R.LPGLIDVHVHLR.E
1286   684.909053   1367.803554   1367.803757   -0.15  0   (58)  6.8e-05  1    R.LPGLIDVHVHLR.E
1300   692.859574   1383.704596   1383.703400   0.86  0   54   0.00048  1    K.LYLNETFSELR.L
1301   692.859574   1383.704596   1383.703400   0.86  0   (44)  0.0041  1    K.LYLNETFSELR.L
1304   697.851694   1393.688836   1393.688477   0.26  0   42   0.0068  1    R.GHNQPCLLVGSGR.C
1305   466.601079   1396.781409   1396.782700   -0.92  0   (32)  0.05  1    R.TPHVLVLGSGVYR.I
1306   466.601079   1396.781409   1396.782700   -0.92  0   (33)  0.04  1    R.TPHVLVLGSGVYR.I
1307   466.601079   1396.781409   1396.782700   -0.92  0   (15)  2.6  1    R.TPHVLVLGSGVYR.I
1308   699.398963   1396.783374   1396.782700   0.48  0   (55)  0.00024  1    R.TPHVLVLGSGVYR.I
1309   699.398963   1396.783374   1396.782700   0.48  0   64   3.1e-05  1    R.TPHVLVLGSGVYR.I
1310   699.398963   1396.783374   1396.782700   0.48  0   (42)  0.0049  1    R.TPHVLVLGSGVYR.I
1319   702.896324   1403.778096   1403.777252   0.60  0   (19)  1.2  1    R.GQPLPPDLLQQAK.C
1320   702.896324   1403.778096   1403.777252   0.60  0   20   0.96  1    R.GQPLPPDLLQQAK.C
1338   476.939964   1427.798064   1427.799698   -1.14  0   (48)  0.0017  1    R.IIAHAQLLEQHR.G
1339   476.939964   1427.798064   1427.799698   -1.14  0   (59)  0.00012  1    R.IIAHAQLLEQHR.G
1340   476.939964   1427.798064   1427.799698   -1.14  0   (38)  0.016  1    R.IIAHAQLLEQHR.G
1341   714.907471   1427.800390   1427.799698   0.48  0   (60)  8.8e-05  1    R.IIAHAQLLEQHR.G
1342   714.907471   1427.800390   1427.799698   0.48  0   66   2.4e-05  1    R.IIAHAQLLEQHR.G
1368   726.828988   1451.643424   1451.642487   0.65  0   55   0.00012  1    K.VMASMFYEVSTR.T + 2 Oxidation (M)
1369   726.828988   1451.643424   1451.642487   0.65  0   (52)  0.00026  1    K.VMASMFYEVSTR.T + 2 Oxidation (M)
1373   729.857887   1457.701222   1457.699799   0.98  0   100   9.5e-09  1    R.VNEISVEVDSDPR.A
1374   729.857887   1457.701222   1457.699799   0.98  0   (89)  1.2e-07  1    R.VNEISVEVDSDPR.A
1375   729.857887   1457.701222   1457.699799   0.98  0   (96)  2.4e-08  1    R.VNEISVEVDSDPR.A
1376   729.857887   1457.701222   1457.699799   0.98  0   (78)  1.4e-06  1    R.VNEISVEVDSDPR.A
1405   779.891360   1557.768168   1557.763443   3.03  0   (62)  7.1e-05  1    R.VLGTSPEAIDSAENR.F
1406   779.891360   1557.768168   1557.763443   3.03  0   (92)  6.3e-08  1    R.VLGTSPEAIDSAENR.F
1407   779.891360   1557.768168   1557.763443   3.03  0   93   5e-08  1    R.VLGTSPEAIDSAENR.F
1408   779.891360   1557.768168   1557.763443   3.03  0   (68)  1.7e-05  1    R.VLGTSPEAIDSAENR.F
1444   836.444546   1670.874540   1670.872681   1.11  0   69   1.5e-05  1    R.VLGTPVETIELTEDR.R
1445   836.444546   1670.874540   1670.872681   1.11  0   (68)  2e-05  1    R.VLGTPVETIELTEDR.R
1448   840.944934   1679.875316   1679.873016   1.37  0   93   5.4e-08  1    R.LGGAVLSFSEATSSVQK.G
1449   840.944934   1679.875316   1679.873016   1.37  0   (70)  1.2e-05  1    R.LGGAVLSFSEATSSVQK.G
1450   840.944934   1679.875316   1679.873016   1.37  0   (71)  1e-05  1    R.LGGAVLSFSEATSSVQK.G
1455   562.278601   1683.813975   1683.815125   -0.68  0   (30)  0.093  1    K.DQMSHLFNVAHTLR.M + Oxidation (M)
1456   562.278601   1683.813975   1683.815125   -0.68  0   41   0.0071  1    K.DQMSHLFNVAHTLR.M + Oxidation (M)
1457   562.278601   1683.813975   1683.815125   -0.68  0   (35)  0.033  1    K.DQMSHLFNVAHTLR.M + Oxidation (M)
1458   562.278601   1683.813975   1683.815125   -0.68  0   (25)  0.31  1    K.DQMSHLFNVAHTLR.M + Oxidation (M)
1459   562.612880   1684.816812   1683.815125   595  0   (22)  0.58  1    K.DQMSHLFNVAHTLR.M + Oxidation (M)
1511   609.998240   1826.972892   1826.973785   -0.49  1   (9)  13  1    R.VLGTPVETIELTEDRR.A
1514   914.495631   1826.976710   1826.973785   1.60  1   36   0.026  1    R.VLGTPVETIELTEDRR.A
  1515   914.495631   1826.976710   1826.973785   1.60  1   (14)  3.6  2    R.VLGTPVETIELTEDRR.A

 
       Proteins matching the same set of peptides:
       IPI00893035    Mass: 238097   Score: 1902   Queries matched: 92
  Tax_Id=9606 Gene_Symbol=CAD Putative uncharacterized protein CAD

2.     IPI00011654    Mass: 50095    Score: 350    Queries matched: 21   emPAI: 0.56
  Tax_Id=9606 Gene_Symbol=TUBB Tubulin beta chain
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
868   520.299829   1038.585106   1038.586212   -1.06  0   54   0.00027  1    R.YLTVAAVFR.G
869   520.299829   1038.585106   1038.586212   -1.06  0   (53)  0.0004  1    R.YLTVAAVFR.G
870   520.299829   1038.585106   1038.586212   -1.06  0   (37)  0.014  1    R.YLTVAAVFR.G
871   520.794125   1039.573698   1038.586212   951  0   (20)  0.75  1    R.YLTVAAVFR.G
  873   520.794494   1039.574436   1038.586212   952  0   (4)  33  7    R.YLTVAAVFR.G
  943   539.269248   1076.523944   1076.525040   -1.02  1   (20)  0.97  2    K.IREEYPDR.I
944   539.269248   1076.523944   1076.525040   -1.02  1   22   0.71  1    K.IREEYPDR.I
1019   565.800798   1129.587044   1129.587997   -0.84  0   39   0.016  1    R.FPGQLNADLR.K
1020   565.800798   1129.587044   1129.587997   -0.84  0   (35)  0.039  1    R.FPGQLNADLR.K
1060   580.317999   1158.621446   1158.621948   -0.43  0   57   0.0003  1    K.LAVNMVPFPR.L + Oxidation (M)
1061   580.317999   1158.621446   1158.621948   -0.43  0   (46)  0.0037  1    K.LAVNMVPFPR.L + Oxidation (M)
1164   623.300093   1244.585634   1244.585953   -0.26  0   (70)  7.5e-06  1    R.ISEQFTAMFR.R + Oxidation (M)
1165   623.300093   1244.585634   1244.585953   -0.26  0   (62)  4.7e-05  1    R.ISEQFTAMFR.R + Oxidation (M)
1166   623.300093   1244.585634   1244.585953   -0.26  0   71   5.9e-06  1    R.ISEQFTAMFR.R + Oxidation (M)
1228   651.322812   1300.631072   1300.629913   0.89  0   40   0.0078  1    R.ISVYYNEATGGK.Y
1262   668.352538   1334.690524   1334.690430   0.07  0   (32)  0.078  1    R.IMNTFSVVPSPK.V + Oxidation (M)
1263   668.352538   1334.690524   1334.690430   0.07  0   45   0.0035  1    R.IMNTFSVVPSPK.V + Oxidation (M)
1379   731.846506   1461.678460   1461.676941   1.04  0   25   0.22  1    K.EVDEQMLNVQNK.N + Oxidation (M)
1435   816.420200   1630.825848   1630.823624   1.36  0   67   2.5e-05  1    R.AILVDLEPGTMDSVR.S + Oxidation (M)
1436   816.420200   1630.825848   1630.823624   1.36  0   (50)  0.0012  1    R.AILVDLEPGTMDSVR.S + Oxidation (M)
1437   816.420200   1630.825848   1630.823624   1.36  0   (56)  0.00035  1    R.AILVDLEPGTMDSVR.S + Oxidation (M)

 
       Proteins matching the same set of peptides:
       IPI00645452    Mass: 48135    Score: 350    Queries matched: 21
  Tax_Id=9606 Gene_Symbol=TUBB Tubulin, beta polypeptide
3.     IPI00007752    Mass: 50255    Score: 330    Queries matched: 20   emPAI: 0.46
  Tax_Id=9606 Gene_Symbol=TUBB2C Tubulin beta-2C chain
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  868   520.299829   1038.585106   1038.586212   -1.06  0   54   0.00027  1    R.YLTVAAVFR.G
  869   520.299829   1038.585106   1038.586212   -1.06  0   (53)  0.0004  1    R.YLTVAAVFR.G
  870   520.299829   1038.585106   1038.586212   -1.06  0   (37)  0.014  1    R.YLTVAAVFR.G
  871   520.794125   1039.573698   1038.586212   951  0   (20)  0.75  1    R.YLTVAAVFR.G
  873   520.794494   1039.574436   1038.586212   952  0   (4)  33  7    R.YLTVAAVFR.G
  943   539.269248   1076.523944   1076.525040   -1.02  1   (20)  0.97  2    K.IREEYPDR.I
  944   539.269248   1076.523944   1076.525040   -1.02  1   22   0.71  1    K.IREEYPDR.I
  1019   565.800798   1129.587044   1129.587997   -0.84  0   39   0.016  1    R.FPGQLNADLR.K
  1020   565.800798   1129.587044   1129.587997   -0.84  0   (35)  0.039  1    R.FPGQLNADLR.K
  1060   580.317999   1158.621446   1158.621948   -0.43  0   57   0.0003  1    K.LAVNMVPFPR.L + Oxidation (M)
  1061   580.317999   1158.621446   1158.621948   -0.43  0   (46)  0.0037  1    K.LAVNMVPFPR.L + Oxidation (M)
  1164   623.300093   1244.585634   1244.585953   -0.26  0   (70)  7.5e-06  1    R.ISEQFTAMFR.R + Oxidation (M)
  1165   623.300093   1244.585634   1244.585953   -0.26  0   (62)  4.7e-05  1    R.ISEQFTAMFR.R + Oxidation (M)
  1166   623.300093   1244.585634   1244.585953   -0.26  0   71   5.9e-06  1    R.ISEQFTAMFR.R + Oxidation (M)
  1262   668.352538   1334.690524   1334.690430   0.07  0   (32)  0.078  1    R.IMNTFSVVPSPK.V + Oxidation (M)
  1263   668.352538   1334.690524   1334.690430   0.07  0   45   0.0035  1    R.IMNTFSVVPSPK.V + Oxidation (M)
  1379   731.846506   1461.678460   1461.676941   1.04  0   25   0.22  1    K.EVDEQMLNVQNK.N + Oxidation (M)
1427   809.412116   1616.809680   1616.807983   1.05  0   (49)  0.0015  1    R.AVLVDLEPGTMDSVR.S + Oxidation (M)
1428   809.412116   1616.809680   1616.807983   1.05  0   (49)  0.0016  1    R.AVLVDLEPGTMDSVR.S + Oxidation (M)
1429   809.412116   1616.809680   1616.807983   1.05  0   66   2.8e-05  1    R.AVLVDLEPGTMDSVR.S + Oxidation (M)

 
       Proteins matching the same set of peptides:
       IPI00911016    Mass: 44916    Score: 330    Queries matched: 20
  Tax_Id=9606 Gene_Symbol=- cDNA FLJ11352 fis, clone HEMBA1000020, highly similar to Tubulin beta-2C chain
4.     IPI00152453    Mass: 89693    Score: 282    Queries matched: 13   emPAI: 0.20
  Tax_Id=9606 Gene_Symbol=TUBB3 HCG2042771
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  585   438.718876   875.423200   875.428329   -5.86  0   13   4.8  4    -.MAVQGSQR.R
  1019   565.800798   1129.587044   1129.587997   -0.84  0   39   0.016  1    R.FPGQLNADLR.K
  1020   565.800798   1129.587044   1129.587997   -0.84  0   (35)  0.039  1    R.FPGQLNADLR.K
  1060   580.317999   1158.621446   1158.621948   -0.43  0   57   0.0003  1    K.LAVNMVPFPR.L + Oxidation (M)
  1061   580.317999   1158.621446   1158.621948   -0.43  0   (46)  0.0037  1    K.LAVNMVPFPR.L + Oxidation (M)
  1164   623.300093   1244.585634   1244.585953   -0.26  0   (70)  7.5e-06  1    R.ISEQFTAMFR.R + Oxidation (M)
  1165   623.300093   1244.585634   1244.585953   -0.26  0   (62)  4.7e-05  1    R.ISEQFTAMFR.R + Oxidation (M)
  1166   623.300093   1244.585634   1244.585953   -0.26  0   71   5.9e-06  1    R.ISEQFTAMFR.R + Oxidation (M)
  1262   668.352538   1334.690524   1334.690430   0.07  0   (32)  0.078  1    R.IMNTFSVVPSPK.V + Oxidation (M)
  1263   668.352538   1334.690524   1334.690430   0.07  0   45   0.0035  1    R.IMNTFSVVPSPK.V + Oxidation (M)
  1435   816.420200   1630.825848   1630.823624   1.36  0   67   2.5e-05  1    R.AILVDLEPGTMDSVR.S + Oxidation (M)
  1436   816.420200   1630.825848   1630.823624   1.36  0   (50)  0.0012  1    R.AILVDLEPGTMDSVR.S + Oxidation (M)
  1437   816.420200   1630.825848   1630.823624   1.36  0   (56)  0.00035  1    R.AILVDLEPGTMDSVR.S + Oxidation (M)

5.     IPI00644620    Mass: 34807    Score: 210    Queries matched: 10   emPAI: 0.44
  Tax_Id=9606 Gene_Symbol=TUBB3 35 kDa protein
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  1019   565.800798   1129.587044   1129.587997   -0.84  0   39   0.016  1    R.FPGQLNADLR.K
  1020   565.800798   1129.587044   1129.587997   -0.84  0   (35)  0.039  1    R.FPGQLNADLR.K
  1024   567.329678   1132.644804   1132.663803   -16.77  1   9   10  4    -.MGTLLISKVR.E + Oxidation (M)
  1060   580.317999   1158.621446   1158.621948   -0.43  0   57   0.0003  1    K.LAVNMVPFPR.L + Oxidation (M)
  1061   580.317999   1158.621446   1158.621948   -0.43  0   (46)  0.0037  1    K.LAVNMVPFPR.L + Oxidation (M)
  1164   623.300093   1244.585634   1244.585953   -0.26  0   (70)  7.5e-06  1    R.ISEQFTAMFR.R + Oxidation (M)
  1165   623.300093   1244.585634   1244.585953   -0.26  0   (62)  4.7e-05  1    R.ISEQFTAMFR.R + Oxidation (M)
  1166   623.300093   1244.585634   1244.585953   -0.26  0   71   5.9e-06  1    R.ISEQFTAMFR.R + Oxidation (M)
  1262   668.352538   1334.690524   1334.690430   0.07  0   (32)  0.078  1    R.IMNTFSVVPSPK.V + Oxidation (M)
  1263   668.352538   1334.690524   1334.690430   0.07  0   45   0.0035  1    R.IMNTFSVVPSPK.V + Oxidation (M)

6.     IPI00011569    Mass: 267095   Score: 90     Queries matched: 5   emPAI: 0.05
  Tax_Id=9606 Gene_Symbol=ACACA Isoform 1 of Acetyl-CoA carboxylase 1
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
851   516.812875   1031.611198   1031.612747   -1.50  0   35   0.02  1    R.AIGIGAYLVR.L
1199   634.313207   1266.611862   1266.609207   2.10  0   49   0.0013  1    K.VEVGTEVTDYR.F
1200   634.313207   1266.611862   1266.609207   2.10  0   (40)  0.0094  1    K.VEVGTEVTDYR.F
1280   683.906763   1365.798974   1365.798019   0.70  0   30   0.031  1    R.LGGIPVGVVAVETR.T
1303   696.380485   1390.746418   1390.745621   0.57  0   52   0.00074  1    R.DIIVIGNDITYR.I

 
       Proteins matching the same set of peptides:
       IPI00396015    Mass: 271538   Score: 90     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=ACACA Isoform 4 of Acetyl-CoA carboxylase 1
       IPI00396018    Mass: 258785   Score: 90     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=ACACA Isoform 3 of Acetyl-CoA carboxylase 1
       IPI00793409    Mass: 266895   Score: 90     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=ACACA 265 kDa protein
       IPI00847501    Mass: 261231   Score: 90     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=ACACA Isoform 2 of Acetyl-CoA carboxylase 1
7.     IPI00220327    Mass: 66149    Score: 89     Queries matched: 7   emPAI: 0.21
  Tax_Id=9606 Gene_Symbol=KRT1 Keratin, type II cytoskeletal 1
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  1014   564.273707   1126.532862   1126.532852   0.01  1   30   0.068  2    K.KDVDGAYMTK.V
1189   633.322305   1264.630058   1264.629913   0.11  0   55   0.0004  1    R.TNAENEFVTIK.K
1190   633.322305   1264.630058   1264.629913   0.11  0   (45)  0.0042  1    R.TNAENEFVTIK.K
1191   633.322305   1264.630058   1264.629913   0.11  0   (52)  0.0007  1    R.TNAENEFVTIK.K
1234   436.889317   1307.646123   1307.646927   -0.61  2   (26)  0.27  1    R.NKYEDEINKR.T
1235   654.830757   1307.646962   1307.646927   0.03  2   29   0.15  1    R.NKYEDEINKR.T
1236   654.830757   1307.646962   1307.646927   0.03  2   (20)  1.2  1    R.NKYEDEINKR.T

8.     IPI00024067    Mass: 193260   Score: 86     Queries matched: 5   emPAI: 0.03
  Tax_Id=9606 Gene_Symbol=CLTC Isoform 1 of Clathrin heavy chain 1
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
1012   563.797911   1125.581270   1125.581833   -0.50  0   67   2e-05  1    K.VANVELYYR.A
1013   563.797911   1125.581270   1125.581833   -0.50  0   (45)  0.0031  1    K.VANVELYYR.A
  1327   472.580163   1414.718661   1414.720474   -1.28  0   (10)  12  6    K.IVLDNSVFSEHR.N
1328   708.367781   1414.721010   1414.720474   0.38  0   34   0.039  1    K.IVLDNSVFSEHR.N
  1597   571.009893   3990.018319   3990.030228   -2.98  2   6   15  6    R.EKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASK.V

 
       Proteins matching the same set of peptides:
       IPI00455383    Mass: 189538   Score: 86     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=CLTC Isoform 2 of Clathrin heavy chain 1
9.     IPI00029446    Mass: 210294   Score: 71     Queries matched: 13   emPAI: 0.03
  Tax_Id=9606 Gene_Symbol=SBF1 Isoform 1 of Myotubularin-related protein 5
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  546   434.759087   867.503622   867.507904   -4.94  0   (8)  7.5  4    R.VPRPFPR.L
  547   434.759092   867.503632   867.507904   -4.92  0   (1)  40  9    R.VPRPFPR.L
  548   434.759096   867.503640   867.507904   -4.92  0   (7)  9.5  2    R.VPRPFPR.L
  549   434.766207   867.517862   867.507904   11.5  0   12   2.6  7    R.VPRPFPR.L
  550   434.766207   867.517862   867.507904   11.5  0   (2)  25  7    R.VPRPFPR.L
  782   494.300529   986.586506   985.566864   1035  1   6   25  2    K.GPSLRTLSR.N
836   513.320659   1024.626766   1023.609009   994  1   20   0.24  1    R.RVPRPFPR.L
  837   513.320659   1024.626766   1023.609009   994  1   (14)  0.95  3    R.RVPRPFPR.L
  838   513.320659   1024.626766   1023.609009   994  1   (8)  3.8  9    R.RVPRPFPR.L
939   538.272079   1074.529606   1074.530533   -0.86  0   51   0.00094  1    R.SALDVASEQR.R
  1161   622.317642   1242.620732   1241.625153   802  0   16   2.3  2    R.LETELGQPAER.W
  1162   622.317642   1242.620732   1241.625153   802  0   (14)  3.5  3    R.LETELGQPAER.W
1416   793.416977   1584.819402   1584.818146   0.79  0   53   0.00054  1    R.TTVPSGPPMTAILER.C + Oxidation (M)

 
       Proteins matching the same set of peptides:
       IPI00218397    Mass: 213740   Score: 71     Queries matched: 13
  Tax_Id=9606 Gene_Symbol=SBF1 Isoform 4 of Myotubularin-related protein 5
       IPI00855761    Mass: 210804   Score: 71     Queries matched: 13
  Tax_Id=9606 Gene_Symbol=SBF1 209 kDa protein
       IPI00853090    Mass: 184013   Score: 71     Queries matched: 13
  Tax_Id=9606 Gene_Symbol=SBF1 SET binding factor 1
10.    IPI00009865    Mass: 59703    Score: 69     Queries matched: 3   emPAI: 0.06
  Tax_Id=9606 Gene_Symbol=KRT10 Keratin, type I cytoskeletal 10
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
787   497.252966   992.491380   992.492676   -1.31  0   (43)  0.0053  1    K.YENEVALR.Q
788   497.252966   992.491380   992.492676   -1.31  0   (43)  0.0055  1    K.YENEVALR.Q
789   497.252966   992.491380   992.492676   -1.31  0   49   0.0014  1    K.YENEVALR.Q

 
       Proteins matching the same set of peptides:
       IPI00884222    Mass: 57384    Score: 69     Queries matched: 3
  Tax_Id=9606 Gene_Symbol=- Similar to Keratin, type I cytoskeletal 10
11.    IPI00293665    Mass: 60274    Score: 55     Queries matched: 5   emPAI: 0.17
  Tax_Id=9606 Gene_Symbol=KRT6B Keratin, type II cytoskeletal 6B
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
988   554.274704   1106.534856   1106.535599   -0.67  0   49   0.0013  1    K.AQYEEIAQR.S
989   554.274704   1106.534856   1106.535599   -0.67  0   (39)  0.013  1    K.AQYEEIAQR.S
  1234   436.889317   1307.646123   1307.646927   -0.61  2   (26)  0.27  1    K.NKYEDEINKR.T
  1235   654.830757   1307.646962   1307.646927   0.03  2   29   0.15  1    K.NKYEDEINKR.T
  1236   654.830757   1307.646962   1307.646927   0.03  2   (20)  1.2  1    K.NKYEDEINKR.T

 
       Proteins matching the same set of peptides:
       IPI00299145    Mass: 60273    Score: 55     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=KRT6C Keratin, type II cytoskeletal 6C
       IPI00300725    Mass: 60293    Score: 55     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=KRT6A Keratin, type II cytoskeletal 6A
       IPI00909059    Mass: 58088    Score: 55     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=- cDNA FLJ53910, highly similar to Keratin, type II cytoskeletal 6A
12.    IPI00021304    Mass: 66110    Score: 55     Queries matched: 3   emPAI: 0.05
  Tax_Id=9606 Gene_Symbol=KRT2 Keratin, type II cytoskeletal 2 epidermal
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  875   521.281710   1040.548868   1040.550217   -1.30  0   12   5.7  6    K.VDPEIQNVK.A
  988   554.274704   1106.534856   1106.535599   -0.67  0   49   0.0013  1    K.AQYEEIAQR.S
  989   554.274704   1106.534856   1106.535599   -0.67  0   (39)  0.013  1    K.AQYEEIAQR.S

13.    IPI00003421    Mass: 74520    Score: 47     Queries matched: 4   emPAI: 0.04
  Tax_Id=9606 Gene_Symbol=TBR1 T-box brain protein 1
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
1214   642.861846   1283.709140   1283.708511   0.49  0   (29)  0.094  1    K.LSPVLDGVSELR.H
1215   642.861846   1283.709140   1283.708511   0.49  0   39   0.0093  1    K.LSPVLDGVSELR.H
1216   642.861846   1283.709140   1283.708511   0.49  0   (37)  0.015  1    K.LSPVLDGVSELR.H
1217   642.861847   1283.709142   1283.708511   0.49  0   (34)  0.031  1    K.LSPVLDGVSELR.H

14.    IPI00910412    Mass: 46230    Score: 44     Queries matched: 1   emPAI: 0.07
  Tax_Id=9606 Gene_Symbol=- cDNA FLJ60844, highly similar to Homo sapiens centrosomal protein 170 kDa (CEP170), transcript variant alpha, mRNA
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
1120   603.348002   1204.681452   1204.681564   -0.09  0   44   0.0034  1    K.FTIQLQLSQK.S

 
       Proteins matching the same set of peptides:
       IPI00186194    Mass: 175586   Score: 44     Queries matched: 1
  Tax_Id=9606 Gene_Symbol=CEP170 Isoform 1 of Centrosomal protein of 170 kDa
       IPI00477477    Mass: 161709   Score: 44     Queries matched: 1
  Tax_Id=9606 Gene_Symbol=CEP170 Isoform 2 of Centrosomal protein of 170 kDa
       IPI00647185    Mass: 179919   Score: 44     Queries matched: 1
  Tax_Id=9606 Gene_Symbol=CEP170 Centrosomal protein 170kDa
       IPI00871460    Mass: 164839   Score: 44     Queries matched: 1
  Tax_Id=9606 Gene_Symbol=CEP170 Isoform 3 of Centrosomal protein of 170 kDa
       IPI00909334    Mass: 101993   Score: 44     Queries matched: 1
  Tax_Id=9606 Gene_Symbol=- cDNA FLJ53512, highly similar to Homo sapiens centrosomal protein 170 kDa (CEP170), transcript variant alpha, mRNA (Fragment)
15.    IPI00019502    Mass: 227646   Score: 42     Queries matched: 7   emPAI: 0.01
  Tax_Id=9606 Gene_Symbol=MYH9 Isoform 1 of Myosin-9
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
667   462.750176   923.485800   923.486511   -0.77  0   23   0.4  1    R.VVFQEFR.Q
1144   612.322328   1222.630104   1222.630569   -0.38  0   (27)  0.26  1    R.AGVLAHLEEER.D
1145   612.823919   1223.633286   1222.630569   820  0   40   0.012  1    R.AGVLAHLEEER.D
  1189   633.322305   1264.630058   1264.633286   -2.55  1   10   12  9    K.LQEMEGTVKSK.Y + Oxidation (M)
  1190   633.322305   1264.630058   1264.633286   -2.55  1   (9)  15  9    K.LQEMEGTVKSK.Y + Oxidation (M)
1253   440.253769   1317.739479   1317.740479   -0.76  0   19   1.1  1    K.LDPHLVLDQLR.C
1254   659.877636   1317.740720   1317.740479   0.18  0   (14)  3.1  1    K.LDPHLVLDQLR.C

 
       Proteins matching the same set of peptides:
       IPI00395772    Mass: 160790   Score: 42     Queries matched: 7
  Tax_Id=9606 Gene_Symbol=MYH9 Isoform 2 of Myosin-9
16.    IPI00397526    Mass: 229827   Score: 42     Queries matched: 5   emPAI: 0.01
  Tax_Id=9606 Gene_Symbol=MYH10 Isoform 1 of Myosin-10
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
684   469.757823   937.501094   937.502151   -1.13  0   23   0.37  1    R.IVFQEFR.Q
  1144   612.322328   1222.630104   1222.630569   -0.38  0   (27)  0.26  1    R.AGVLAHLEEER.D
  1145   612.823919   1223.633286   1222.630569   820  0   40   0.012  1    R.AGVLAHLEEER.D
  1253   440.253769   1317.739479   1317.740479   -0.76  0   19   1.1  1    K.LDPHLVLDQLR.C
  1254   659.877636   1317.740720   1317.740479   0.18  0   (14)  3.1  1    K.LDPHLVLDQLR.C

 
       Proteins matching the same set of peptides:
       IPI00479307    Mass: 231606   Score: 42     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=MYH10 Isoform 2 of Myosin-10
       IPI00790503    Mass: 232195   Score: 42     Queries matched: 5
  Tax_Id=9606 Gene_Symbol=MYH10 Isoform 3 of Myosin-10
17.    IPI00014424    Mass: 50780    Score: 41     Queries matched: 3   emPAI: 0.06
  Tax_Id=9606 Gene_Symbol=EEF1A2 Elongation factor 1-alpha 2
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  570   435.773736   869.532920   869.533447   -0.61  0   (1)  34  4    K.QLIVGVNK.M
  572   435.773756   869.532960   869.533447   -0.56  0   6   11  9    K.QLIVGVNK.M
835   513.308256   1024.601960   1024.602951   -0.97  0   41   0.0034  1    K.IGGIGTVPVGR.V

 
       Proteins matching the same set of peptides:
       IPI00396485    Mass: 50451    Score: 41     Queries matched: 3
  Tax_Id=9606 Gene_Symbol=EEF1A1 Elongation factor 1-alpha 1
       IPI00472724    Mass: 50495    Score: 41     Queries matched: 3
  Tax_Id=9606 Gene_Symbol=EEF1AL3;EEF1A1 Putative elongation factor 1-alpha-like 3
       IPI00556204    Mass: 37116    Score: 41     Queries matched: 3
  Tax_Id=9606 Gene_Symbol=EEF1A2 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment)
18.    IPI00382401    Mass: 13218    Score: 41     Queries matched: 2   emPAI: 0.26
  Tax_Id=9606 Gene_Symbol=CENPL cDNA FLJ31786 fis, clone NT2RI2008526
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
1389   742.865774   1483.716996   1482.724899   669  1   41   0.007  1    R.KCPSQSEVAGPAPR.L
  1390   742.865774   1483.716996   1482.724899   669  1   (11)  6.8  2    R.KCPSQSEVAGPAPR.L

19.    IPI00642952    Mass: 10788    Score: 39     Queries matched: 2   emPAI: 0.32
  Tax_Id=9606 Gene_Symbol=- Hypothetical protein
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  627   450.274343   898.534134   898.523621   11.7  0   2   47  6    R.GAVVGLDLR.M
1168   623.338160   1244.661768   1243.652039   812  1   39   0.019  1    R.EDIISDLRQR.R

20.    IPI00456492    Score: 38     Queries matched: 2
  Tax_Id=9606 Gene_Symbol=CROCC Isoform 1 of Rootletin
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  933   536.804302   1071.594052   1070.583237   944  0   38   0.022  2    R.AQLQSQLQR.E
  934   536.804302   1071.594052   1070.583237   944  0   (33)  0.071  2    R.AQLQSQLQR.E

 
       Proteins matching the same set of peptides:
       IPI00644892    Score: 38     Queries matched: 2
21.    IPI00440016    Score: 37     Queries matched: 3
  Tax_Id=9606 Gene_Symbol=P2RX6 P2RX6 protein
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  908   530.812154   1059.609756   1058.612396   942  1   (28)  0.15  2    K.TEKWALLAK.K
  909   530.812154   1059.609756   1058.612396   942  1   37   0.018  2    K.TEKWALLAK.K
  910   530.812154   1059.609756   1058.612396   942  1   (18)  1.4  7    K.TEKWALLAK.K

 
       Proteins matching the same set of peptides:
       IPI00878641    Score: 37     Queries matched: 3
22.    IPI00169307    Score: 37     Queries matched: 4
  Tax_Id=9606 Gene_Symbol=ARHGAP21 Rho GTPase activating protein 21
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  678   467.269206   932.523860   932.505280   19.9  1   8   20  3    R.RHTLGGHR.D
  908   530.812154   1059.609756   1059.607651   1.99  1   (27)  0.17  3    R.FAILKESPR.S
  909   530.812154   1059.609756   1059.607651   1.99  1   37   0.018  3    R.FAILKESPR.S
  910   530.812154   1059.609756   1059.607651   1.99  1   (21)  0.77  4    R.FAILKESPR.S

 
       Proteins matching the same set of peptides:
       IPI00867539    Score: 37     Queries matched: 4
23.    IPI00745955    Mass: 40830    Score: 36     Queries matched: 2   emPAI: 0.08
  Tax_Id=9606 Gene_Symbol=EBNA1BP2 EBNA1 binding protein 2
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
917   533.263697   1064.512842   1064.492020   19.6  1   36   0.027  1    K.QAAMERSEK.A + Oxidation (M)
  918   533.263697   1064.512842   1064.492020   19.6  1   (13)  5  6    K.QAAMERSEK.A + Oxidation (M)

24.    IPI00790962    Score: 35     Queries matched: 3
  Tax_Id=9606 Gene_Symbol=NEU4 sialidase 4
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  747   487.790005   973.565458   972.546478   1048  1   13   5  6    R.RGTLAGGSVR.W
  823   510.253376   1018.492200   1018.483200   8.84  0   35   0.034  2    R.DAGLSWGSAR.D
  824   510.253376   1018.492200   1018.483200   8.84  0   (9)  15  8    R.DAGLSWGSAR.D

 
       Proteins matching the same set of peptides:
       IPI00892845    Score: 35     Queries matched: 3
       IPI00893103    Score: 35     Queries matched: 3
       IPI00894408    Score: 35     Queries matched: 3
25.    IPI00218743    Score: 35     Queries matched: 3
  Tax_Id=9606 Gene_Symbol=BEST1 Isoform 2 of Bestrophin-1
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  1164   623.300093   1244.585634   1243.568024   818  0   35   0.025  2    R.EAEAGESLEPGR.R
  1165   623.300093   1244.585634   1243.568024   818  0   (12)  5.1  4    R.EAEAGESLEPGR.R
  1166   623.300093   1244.585634   1243.568024   818  0   (20)  0.77  2    R.EAEAGESLEPGR.R

 
       Proteins matching the same set of peptides:
       IPI00555899    Score: 35     Queries matched: 3
       IPI00792452    Score: 35     Queries matched: 3
26.    IPI00167180    Score: 35     Queries matched: 1
  Tax_Id=9606 Gene_Symbol=TTC18 122 kDa protein
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  1168   623.338160   1244.661768   1243.670654   797  2   35   0.049  2    R.MPEELARRVK.E + Oxidation (M)

 
       Proteins matching the same set of peptides:
       IPI00217938    Score: 35     Queries matched: 1
       IPI00513680    Score: 35     Queries matched: 1
       IPI00902826    Score: 35     Queries matched: 1
27.    IPI00007675    Score: 35     Queries matched: 3
  Tax_Id=9606 Gene_Symbol=DYNC1LI1 Cytoplasmic dynein 1 light intermediate chain 1
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  161   474.290426   473.283150   472.275772   2133  0   6   44  5    M.AAVGR.V
  703   472.287458   942.560364   942.561035   -0.71  2   7   18  3    R.SRSKLPAGK.N
  761   490.773532   979.532512   978.538589   1016  0   35   0.031  2    K.FSLDAVSLK.D

28.    IPI00022881    Mass: 189020   Score: 34     Queries matched: 4   emPAI: 0.02
  Tax_Id=9606 Gene_Symbol=CLTCL1 Isoform 1 of Clathrin heavy chain 2
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
  243   574.306875   573.299599   572.291824   1761  0   2   40  6    R.NPTGGK.L
  1327   472.580163   1414.718661   1414.720474   -1.28  0   (10)  12  6    K.IVLDNSVFSEHR.N
  1328   708.367781   1414.721010   1414.720474   0.38  0   34   0.039  1    K.IVLDNSVFSEHR.N
  1428   809.412116   1616.809680   1616.783447   16.2  0   4   48  9    K.FNTLFAQGSYAEAAK.V

 
       Proteins matching the same set of peptides:
       IPI00300446    Mass: 182177   Score: 34     Queries matched: 4
  Tax_Id=9606 Gene_Symbol=CLTCL1 Isoform 2 of Clathrin heavy chain 2
29.    IPI00168218    Mass: 37651    Score: 32     Queries matched: 4   emPAI: 0.09
  Tax_Id=9606 Gene_Symbol=DOK7 Isoform 2 of Protein Dok-7
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
1500   897.912703   1793.810854   1792.779892   575  0   32   0.042  1    R.DSGGQTSAGCPSGWLGTR.R
1501   897.912703   1793.810854   1792.779892   575  0   (19)  0.78  1    R.DSGGQTSAGCPSGWLGTR.R
1502   897.912703   1793.810854   1792.779892   575  0   (22)  0.42  1    R.DSGGQTSAGCPSGWLGTR.R
1503   897.912703   1793.810854   1792.779892   575  0   (22)  0.37  1    R.DSGGQTSAGCPSGWLGTR.R

 
       Proteins matching the same set of peptides:
       IPI00783555    Mass: 64639    Score: 32     Queries matched: 4
  Tax_Id=9606 Gene_Symbol=DOK7 Isoform 3 of Protein Dok-7
       IPI00783590    Mass: 53805    Score: 32     Queries matched: 4
  Tax_Id=9606 Gene_Symbol=DOK7 Isoform 1 of Protein Dok-7
30.    IPI00296259    Mass: 26097    Score: 31     Queries matched: 2   emPAI: 0.13
  Tax_Id=9606 Gene_Symbol=TMED4 Isoform 1 of Transmembrane emp24 domain-containing protein 4
Check to include this hit in error tolerant search or archive report
        
       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
427   399.739989   797.465426   796.455536   1268  0   31   0.034  1    M.AGVGAGPLR.A
428   399.739989   797.465426   796.455536   1268  0   (16)  1.2  1    M.AGVGAGPLR.A

 
       Proteins matching the same set of peptides:
       IPI00914891    Mass: 24225    Score: 31     Queries matched: 2
  Tax_Id=9606 Gene_Symbol=TMED4 Isoform 2 of Transmembrane emp24 domain-containing protein 4
       IPI00914908    Mass: 20939    Score: 31     Queries matched: 2
  Tax_Id=9606 Gene_Symbol=TMED4 Isoform 3 of Transmembrane emp24 domain-containing protein 4
Peptide matches not assigned to protein hits: (no details means no match)

       Query   Observed   Mr(expt)   Mr(calc)    ppm   Miss  Score  Expect  Rank   Peptide
447   410.731595   819.448638   819.456253   -9.29  1   32   0.08  1    ITSSRTR
1329   708.834119   1415.653686   1414.658447   704  0   31   0.05  1    CLMDQLHEELK
774   493.234609   984.454666   984.444244   10.6  0   31   0.038  1    MSTVICMK + Oxidation (M)
854   517.243013   1032.471474   1032.490997   -18.91  0   31   0.053  1    AVMAAGDGDVK
1208   637.317517   1272.620482   1272.608475   9.43  0   30   0.078  1    EELEEIASEPK
477   418.229511   834.444470   834.449371   -5.87  2   30   0.1  1    MASRARK + Oxidation (M)
1014   564.273707   1126.532862   1126.532837   0.02  1   30   0.064  1    KDVDAAYMSK
604   442.763546   883.512540   883.512695   -0.18  0   29   0.06  1    LADILSPR
1337   714.879726   1427.744900   1426.760223   690  0   29   0.16  1    QMVGGQQLPALAAK + Oxidation (M)
1062   580.806222   1159.597892   1159.594528   2.90  1   29   0.17  1    ATVNSQEQKR
1336   714.378411   1426.742270   1426.760223   -12.58  0   28   0.18  1    QMVGGQQLPALAAK + Oxidation (M)
1330   708.834119   1415.653686   1414.636444   719  0   28   0.094  1    YLQEHPEDQEK
1148   614.338228   1226.661904   1226.673080   -9.11  1   28   0.15  1    LEAARAAEQLR
436   404.712589   807.410626   807.412659   -2.52  0   28   0.18  1    ELGFGSAK
430   402.716012   803.417472   803.432327   -18.49  0   27   0.31  1    MAAAATLR
325   691.351495   690.344219   690.337036   10.4  0   27   0.25  1    MEAVNK
1478   857.958764   1713.902976   1713.869263   19.7  2   27   0.25  1    IEAASMSGAGRRTVHR + Oxidation (M)
697   472.275528   942.536504   942.524673   12.6  0   27   0.25  1    VSTVERPR
727   480.279078   958.543604   958.552109   -8.87  1   26   0.34  1    MTILPEKK
345   360.171324   718.328096   718.324570   4.91  0   26   0.11  1    DSQNAGK
860   518.316705   1034.618858   1033.613998   972  2   26   0.097  1    KKLMMLVR + Oxidation (M)
486   421.758081   841.501610   841.488205   15.9  2   26   0.19  1    RKAGSAPR
1364   723.365859   1444.717166   1444.741806   -17.05  1   25   0.3  1    TTVTMSMHLLPKA + Oxidation (M)
635   451.768784   901.523016   900.502869   1133  0   25   0.42  1    LDVQLASR
705   472.750839   943.487126   942.477036   1072  0   25   0.26  1    TVEEAAAPR
1048   575.842179   1149.669806   1148.689041   854  2   25   0.15  1    SRVKPPPGRR
527   428.766203   855.517854   854.519852   1168  2   25   0.19  1    RGGGKKPR
920   534.275655   1066.536758   1066.515549   19.9  1   25   0.33  1    EASRFSAGSR
631   450.760834   899.507116   898.505844   1114  0   25   0.3  1    LLQLCPR
319   338.193071   674.371590   674.359894   17.3  0   25   0.71  1    SKPGSSL
528   428.766204   855.517856   855.517792   0.07  0   25   0.21  1    VTIASLPR
266   604.353990   603.346714   602.338760   1673  0   24   0.4  1    QISQK
1063   581.326977   1160.639402   1159.619659   879  1   24   0.44  1    SLRLEEQSAK
694   472.274992   942.535432   942.532059   3.58  0   24   0.41  1    QGLIMLPR + Oxidation (M)
698   472.275528   942.536504   941.540649   1058  1   24   0.45  1    RALGTPTAR
1149   614.338228   1226.661904   1226.673080   -9.11  1   24   0.4  1    LEAARAAEQLR
446   410.729003   819.443454   818.431992   1236  0   24   0.54  1    MSAAQALK
843   515.299904   1028.585256   1028.597824   -12.22  1   24   0.51  1    LGLTLNKDR
1229   651.371656   1300.728760   1300.739761   -8.46  2   23   0.48  1    LLSMTVRRGPR + Oxidation (M)
943   539.269248   1076.523944   1076.517197   6.27  0   23   0.47  1    IPSTEDLMR + Oxidation (M)
928   535.285030   1068.555508   1067.572357   921  1   23   0.44  1    AQTGPPRVDK
759   490.267677   978.520802   977.507645   1036  1   23   0.55  1    RATGSTVMR
1497   349.185545   1740.891345   1740.857010   19.7  0   23   0.56  1    VFPSLDEEVPPAEANK
586   439.253210   876.491868   875.489838   1145  1   23   0.49  1    QLSKAAMK
1121   604.353990   1206.693428   1206.685974   6.18  1   23   0.3  1    TFIAVLSLSKE
790   497.763083   993.511614   992.517853   1001  0   23   0.55  1    IFETLQDK
1348   719.857167   1437.699782   1437.676926   15.9  1   23   0.53  1    KENSMDTASQAIK + Oxidation (M)
280   314.166522   626.318492   626.317627   1.38  0   23   0.17  1    AAFYR
1542   737.706601   2210.097975   2209.104858   450  2   23   0.62  1    KGFAELQTDMTDLTKELNR
1515   914.495631   1826.976710   1826.986313   -5.26  2   22   0.55  1    LEHAQARLTLSYNRR
766   491.803839   981.593126   980.601852   1011  0   22   0.16  1    IPVNIVAQK
700   472.275530   942.536508   942.524658   12.6  1   22   0.64  1    AAAAGTKTPR
380   373.213037   744.411522   743.419083   1335  1   22   1.1  1    AWVGRR
429   401.262052   800.509552   800.498047   14.4  2   22   0.48  1    RAKITGR
583   437.234224   872.453896   872.460312   -7.35  1   22   0.54  1    EATPAKEK
585   438.718876   875.423200   874.433060   1132  0   22   0.63  1    MAAATASPR
699   472.275530   942.536508   942.549805   -14.11  0   22   0.7  1    EAATLLVAR
407   389.209458   776.404364   776.410202   -7.52  0   22   0.9  1    GLLSEMK
976   550.295862   1098.577172   1097.590332   899  1   22   0.58  1    KFTVTVTMR + Oxidation (M)
390   379.250027   756.485502   756.485748   -0.33  1   22   0.44  1    IIDKLR
932   536.292818   1070.571084   1070.550888   18.9  0   22   0.66  1    KPSGPEPGFR
274   308.194902   614.375252   614.375153   0.16  0   22   0.72  1    ILVDR
414   393.210775   784.406998   783.406128   1278  0   22   0.33  1    MELHVR
776   493.317574   984.620596   984.633133   -12.73  2   22   0.29  1    IQKDLKIK
415   394.729197   787.443842   786.446030   1269  1   22   1.1  1    GAAGTRVR
473   417.239409   832.464266   831.463654   1203  0   22   0.96  1    MAVVSAVR
1347   719.857167   1437.699782   1437.709946   -7.07  1   21   0.72  1    FENSISRLTEDK
1181   628.335900   1254.657248   1253.647644   805  1   21   0.76  1    DHSRILVGDSR
1004   561.282651   1120.550750   1119.556015   889  1   21   0.82  1    NSTEWEKVK
496   421.759131   841.503710   840.492966   1203  1   21   0.42  1    TALRGAPR
877   522.769132   1043.523712   1043.511002   12.2  1   21   0.69  1    FDIKSFCK
498   422.259724   842.504896   841.502136   1192  1   21   0.6  1    VAGAATPKK
1371   729.414822   1456.815092   1456.824890   -6.73  2   21   0.74  1    IRAELKEIETQK
377   370.735497   739.456442   738.438797   1378  0   21   0.25  1    EKPLPR
875   521.281710   1040.548868   1039.566193   945  0   21   0.7  1    VLEVNPQNK
931   536.292815   1070.571078   1070.572006   -0.87  0   21   0.81  1    QADVNLVNAK
1385   736.871600   1471.728648   1470.750046   665  0   21   0.83  1    SNLSHLLDLMGSGK
202   516.301218   515.293942   514.286346   1959  0   21   0.64  1    VSGPR
1087   393.230899   1176.670869   1175.644455   873  2   21   0.61  1    KGKNGVAIMSR + Oxidation (M)
1361   723.365859   1444.717166   1444.741806   -17.05  1   21   0.9  1    TTVTMSMHLLPKA + Oxidation (M)
1043   574.300872   1146.587192   1145.597504   864  1   21   1.2  1    STLAMSPRQR
852   517.243013   1032.471474   1031.485855   956  0   21   0.51  1    VNFHVECK
560   435.267702   868.520852   867.517792   1156  0   21   0.36  1    LSPVISPR
1324   705.890818   1409.767084   1408.756180   718  2   21   0.7  1    VKLEDKSSTAFGK
1390   742.865774   1483.716996   1482.721527   671  1   20   0.81  1    GLTPREFNSYGSR
872   520.794494   1039.574436   1038.570953   966  1   20   0.7  1    GPELDVKGPK
653   458.787374   915.560196   914.554871   1099  2   20   0.66  1    SKKALANAL
1499   872.942042   1743.869532   1742.879898   568  0   20   1.1  1    AQSQSGVDLQEDVLVR
327   346.706551   691.398550   690.384659   1469  1   20   0.83  1    MAGLKR + Oxidation (M)
346   360.175169   718.335786   717.330185   1402  0   20   0.86  1    MPMPSR
521   426.725436   851.436320   850.440933   1170  1   20   0.89  1    NSVGYRR
715   477.230082   952.445612   951.441010   1056  0   20   0.64  1    QSGGAGQYGK
1134   609.335245   1216.655938   1215.650604   827  1   20   1.3  1    TRPNMGAVRSK
670   463.768925   925.523298   924.525330   1079  1   20   0.67  1    RAVAQGAPR
853   517.243013   1032.471474   1031.477127   964  0   20   0.61  1    TASTPTPDDK
1230   651.371656   1300.728760   1299.751038   752  1   20   1.1  1    TAVNVALIRDTK
1056   576.780013   1151.545474   1151.549225   -3.26  1   20   0.86  1    ISCKSVDESK
481   420.744734   839.474916   839.475250   -0.40  0   20   0.6  1    LSVEAPPK
926   534.753055   1067.491558   1067.503616   -11.30  0   20   0.6  1    GQDPGAQPWL
663   462.238145   922.461738   922.465424   -4.00  2   20   0.99  1    GNSRSMKK + Oxidation (M)
1543   737.706601   2210.097975   2210.115356   -7.86  2   20   1.2  1    TWYVGKINRTQAEEMLSGK
572   435.773756   869.532960   869.519516   15.5  1   20   0.53  1    GAAVRGALR
748   487.790091   973.565630   973.566864   -1.27  1   20   1.1  1    RAVSTATLR
529   428.766204   855.517856   855.517792   0.07  0   20   0.67  1    VTIASLPR
495   421.759131   841.503710   840.492966   1203  1   19   0.66  1    DRPIRGK
1362   723.365859   1444.717166   1443.688187   713  0   19   1.2  1    SDAPTSSSFFTGLK
312   336.705212   671.395872   671.396622   -1.12  0   19   1.4  1    TVSIPR
607   443.272366   884.530180   883.535156   1126  2   19   0.81  1    RGKASLPR
660   461.279102   920.543652   919.523926   1109  1   19   0.63  1    AQALFKSR
549   434.766207   867.517862   867.517792   0.08  0   19   0.48  1    LSPVISPR
505   424.753080   847.491608   846.485764   1188  2   19   0.98  1    RKMIGSR
1077   389.253629   1164.739059   1163.725067   871  2   19   0.084  1    HIRKLLSAAR
874   521.281710   1040.548868   1040.561462   -12.10  0   19   1  1    NVTAIQGPGGK
497   421.759131   841.503710   841.513367   -11.48  1   19   0.7  1    IGRLVER
959   544.290380   1086.566208   1086.545807   18.8  0   19   1.6  1    GPSPSYLGGPR
1211   641.882045   1281.749538   1280.756454   775  1   19   0.48  1    TTPALLPLSGRR
930   536.292813   1070.571074   1069.587967   919  1   19   1.2  1    LLSPAREER
1133   609.335245   1216.655938   1216.648529   6.09  1   19   1.7  1    METALAKTPQK
1080   583.818542   1165.622532   1165.627731   -4.46  1   19   1.3  1    SLVMELRYR
847   516.301218   1030.587884   1030.588303   -0.41  1   19   1.4  1    SRSASAIALR
487   421.758115   841.501678   840.492966   1200  1   19   0.86  1    VRLSNPR
492   421.758329   841.502106   841.502136   -0.04  1   19   0.74  1    VAGAATPKK
445   407.760618   813.506684   813.495987   13.1  0   19   0.94  1    LNEVIVK
791   497.763083   993.511614   992.517853   1001  0   19   1.4  1    IFETLQDK
918   533.263697   1064.512842   1064.532425   -18.40  2   19   1.3  1    AKEWEMKK + Oxidation (M)
534   432.732134   863.449716   863.438889   12.5  0   19   1.8  1    FGPDTSLK
882   523.284948   1044.555344   1044.571609   -15.57  0   19   2  1    LSSAHVYLR
695   472.275495   942.536438   941.519516   1080  1   19   1.5  1    SLARGWPR
883   523.284953   1044.555354   1044.571609   -15.56  0   19   2.1  1    LSSAHVYLR
283   316.180753   630.346954   630.344925   3.22  0   19   2.2  1    LTGGQR
1209   637.317517   1272.620482   1272.628296   -6.14  2   19   1.2  1    DNKASGGRAAGGGR
1331   708.834119   1415.653686   1415.678848   -17.77  0   19   0.86  1    CLMDLLHEELK + Oxidation (M)
709   475.276480   948.538408   948.525330   13.8  1   19   1.1  1    RHSSLPPR
1005   561.282651   1120.550750   1120.536865   12.4  1   19   1.6  1    MREAVQEMK
767   492.242524   982.470496   981.481445   1008  0   18   1  1    HLPSVCGGR
884   523.284954   1044.555356   1044.538605   16.0  2   18   2.2  1    DKSHVKMGK + Oxidation (M)
1103   597.791051   1193.567550   1193.578400   -9.09  1   18   1.3  1    ETKMLMAAGDK
422   397.723050   793.431548   792.438156   1254  0   18   1.3  1    IGTFDLK
833   512.772783   1023.531014   1023.523666   7.18  1   18   1.4  1    LATDDFKSK
1041   573.306357   1144.598162   1144.598892   -0.64  1   18   1.9  1    WKSDVALNGR
691   471.783725   941.552898   941.563110   -10.85  2   18   1.1  1    TRTRRPR
633   451.758071   901.501590   901.486877   16.3  0   18   2.6  1    SLLQAGADK
636   452.259620   902.504688   901.488205   1128  1   18   2.5  1    YRLHASR
733   482.266037   962.517522   962.518555   -1.07  0   18   1.8  1    VGIVFTDGR
298   323.171351   644.328150   643.328934   1553  0   18   0.97  1    GSPAGGAK
1461   846.440707   1690.866862   1689.890564   578  2   18   2.1  1    DQVKKNQLIQMAMK + Oxidation (M)
1372   729.414822   1456.815092   1456.824890   -6.73  2   18   1.5  1    IRAELKEIETQK
1044   574.769896   1147.525240   1147.546921   -18.89  0   18   0.91  1    DSAVAISGADSR
418   396.199216   790.383880   789.391541   1257  0   18   1.5  1    MSQRPR + Oxidation (M)
421   397.723050   793.431548   792.420395   1276  0   18   1.5  1    FPVATMK
1484   861.445950   1720.877348   1719.864822   589  1   18   2  1    VMVVGPTDVGKSTVCR + Oxidation (M)
668   462.770727   923.526902   923.518845   8.72  1   18   0.94  1    KSTAPPAPR
1161   622.317642   1242.620732   1242.631653   -8.79  1   18   1.6  1    ENGGGGDGRALLK
412   392.748649   783.482746   783.485413   -3.40  2   18   0.64  1    LPAKKID
632   450.760834   899.507116   898.494598   1127  0   18   1.5  1    NLMLQALP
722   479.277066   956.539580   956.526398   13.8  2   18   1.7  1    RSPRGATGR
1327   472.580163   1414.718661   1413.741150   691  1   18   1.7  1    MRDSRPFPRPR
1468   566.631633   1696.873071   1696.842712   17.9  2   18   2  1    RPSPGEMRDQSPKGR
879   522.813027   1043.611502   1043.619949   -8.09  2   18   1.9  1    TSVRKNAIR
413   392.748649   783.482746   783.485413   -3.40  1   18   0.65  1    LAPKDIK
817   507.289503   1012.564454   1011.560059   993  0   18   1.2  1    SPGLPVSDLK
665   462.268337   922.522122   922.523605   -1.61  0   18   1.1  1    SSLPPGIPR
1409   781.342525   1560.670498   1560.680450   -6.38  2   18   0.41  1    DGEPSGHKEFRESS
470   415.253645   828.492738   827.497696   1202  1   18   2.1  1    LAELARR
1115   600.332974   1198.651396   1198.674362   -19.16  1   18   2  1    DEVLKIMPVR
535   432.732134   863.449716   863.436188   15.7  0   18   2.3  1    QGPAAGHAR
683   469.276286   936.538020   935.522217   1086  2   18   0.94  1    RKSSTMVK
696   472.275520   942.536488   941.529404   1070  0   18   2  1    EGTLAAKPR
432   404.232796   806.451040   805.459229   1231  2   17   1.7  1    RTVKMR + Oxidation (M)
1465   566.311031   1695.911265   1694.895142   600  0   17   1.5  1    IKPAATSHVEGSGGVSAK
571   435.773749   869.532946   868.513031   1174  1   17   0.87  1    VPQKELR
1233   652.873259   1303.731966   1302.707779   786  1   17   1.6  1    LVMSQANVSRAK
490   421.758273   841.501994   841.502136   -0.17  1   17   1.1  1    VELPTKR
771   492.284874   982.555196   982.563354   -8.30  0   17   1.1  1    LLSCLLHK
1392   495.958271   1484.852985   1484.863602   -7.15  1   17   1.2  1    LASIMSKLPLATPK + Oxidation (M)
587   439.756740   877.498928   876.506897   1132  1   17   1.4  1    GVLEGFKK
772   492.771082   983.527612   982.526962   1018  1   17   1.4  1    MKYSIVSR
369   367.698008   733.381464   732.383987   1362  0   17   2.6  1    MIPASAK + Oxidation (M)
838   513.320659   1024.626766   1023.607666   996  0   17   0.51  1    NAVTPLKPGK
784   496.303468   990.592384   990.597427   -5.09  2   17   0.7  1    KSFNKIVR
815   507.289503   1012.564454   1012.548767   15.5  1   17   1.3  1    IKNGTPPMR
1346   480.239660   1437.697152   1436.675140   711  2   17   2  1    EKQEDIMNRMK + Oxidation (M)
713   476.768024   951.521496   950.504120   1070  1   17   1.7  1    AMMKVISR + Oxidation (M)
1377   486.958595   1457.853957   1457.835449   12.7  1   17   1  1    TAFTIPAIKGVGQR
1256   663.293116   1324.571680   1324.586334   -11.06  1   17   0.61  1    MQANSDKAMSAR + Oxidation (M)
577   435.775039   869.535526   869.519516   18.4  1   17   0.83  1    GAAVRGALR
861   518.316705   1034.618858   1034.609741   8.81  1   17   0.73  1    VQALRHGVR
689   471.285631   940.556710   940.556625   0.09  1   17   0.94  1    QLRGQIAR
1472   849.445959   1696.877366   1695.901627   575  1   17   2.3  1    GGSSATSGTPRAGLKPPR
1042   574.300872   1146.587192   1146.581528   4.94  1   17   2.9  1    MASSGVKNTPR
1386   738.369560   1474.724568   1474.721176   2.30  2   17   2.2  1    VKGGCGQRGTYHR
478   419.736039   837.457526   837.445694   14.1  0   17   1.5  1    GLVAEGHR
692   471.791705   941.568858   941.559250   10.2  2   17   1.4  1    MARAKLPR
385   375.709548   749.404544   748.386780   1360  0   17   2.3  1    YAGVSPR
1547   742.378529   2224.113759   2223.091522   460  2   17   2.5  1    DFPELTMEVDGKVESIMKR
1399   758.410851   1514.807150   1513.828629   646  1   17   2.5  1    TVLMLQKENLPGR + Oxidation (M)
561   435.722844   869.431136   869.431671   -0.62  1   17   1.5  1    SMFEKTK
1272   674.314304   1346.614056   1346.595856   13.5  1   17   1.2  1    GTSETQRMYMK + Oxidation (M)
747   487.790005   973.565458   972.560364   1033  1   17   2.3  1    EDLSKIIR
416   395.227016   788.439480   787.437424   1273  1   17   3.3  1    KAVMAPR + Oxidation (M)
822   509.803104   1017.591656   1017.597107   -5.36  0   17   1.9  1    TPLPLAGPPR
710   475.294486   948.574420   947.555237   1076  1   17   0.79  1    TNGKFLIR
615   448.213987   894.413422   894.411682   1.95  0   17   1.4  1    SSCEVVSK
622   448.717372   895.420192   894.411682   1128  0   17   1.4  1    SSCEVVSK
649   457.768551   913.522550   912.528030   1090  0   17   2.1  1    GLLTVDPAK
542   433.716097   865.417642   865.403763   16.0  0   16   2  1    VMDMVQK + Oxidation (M)
1204   635.871372   1269.728192   1269.704086   19.0  1   16   1.8  1    LGSGPSIKALDGR
178   487.292537   486.285261   486.291412   -12.65  0   16   2.1  1    ALAGR
749   487.790101   973.565650   972.546448   1048  2   16   2.3  1    SSKPDRKR
904   528.763593   1055.512634   1055.532120   -18.46  1   16   1.6  1    TSALMDKFK + Oxidation (M)
503   423.713768   845.412984   844.415100   1182  1   16   2.4  1    RGAEADAR
961   544.303814   1086.593076   1086.596756   -3.39  2   16   3.4  1    AKQAKMAPSR
420   397.213764   792.412976   792.401764   14.1  0   16   2.9  1    SPDSFLK
821   509.802989   1017.591426   1016.586594   988  1   16   2  1    SVSQDLIKK
1549   742.378529   2224.113759   2224.076065   16.9  1   16   2.8  1    SITDKTSGGPSSGGGFVDWTLR
1186   630.859739   1259.704926   1258.681580   813  1   16   2.4  1    MLRGSGLPAVSR + Oxidation (M)
1049   575.843014   1149.671476   1148.677811   865  2   16   1.1  1    RVNHTLGPKK
701   472.275530   942.536508   941.540649   1058  1   16   2.7  1    RVSNTPLR
1167   623.311028   1244.607504   1244.618301   -8.67  0   16   2.5  1    IMDNGIQGELR
1251   659.312713   1316.610874   1316.629578   -14.21  1   16   1.5  1    FGCRHVTSPVAS
1162   622.317642   1242.620732   1241.607422   816  1   16   2.3  1    SSFSKIGCTGAK
411   392.748649   783.482746   782.487488   1272  2   16   0.93  1    KRVPQR
804   501.290030   1000.565508   1000.577759   -12.24  1   16   3.1  1    SLAITQGRR
540   433.250595   864.486638   863.472580   1174  2   16   1.9  1    GKSGGRFR
368   367.196271   732.377990   731.374847   1372  0   16   4  1    VCAQVR
1079   583.818542   1165.622532   1165.627731   -4.46  1   16   2.7  1    MLANFLASRK + Oxidation (M)
1070   583.295794   1164.577036   1164.588745   -10.05  0   16   3  1    SPDGAVHVVER
1544   737.706601   2210.097975   2210.064407   15.2  1   16   2.9  1    TVNLTDFSNKWDSTNPFPK
1100   596.873944   1191.733336   1191.720001   11.2  2   16   0.34  1    SPAPKVRKPGR
409   390.732911   779.451270   778.444962   1293  1   16   1.6  1    RTLSFR
590   440.225101   878.435650   877.443970   1130  1   16   2.7  1    MSGIGNKR + Oxidation (M)
488   421.758205   841.501858   841.513367   -13.68  1   16   1.8  1    LGLRLDR
962   545.316344   1088.618136   1088.597809   18.7  0   16   2.9  1    GALEAFAAALR
912   531.815966   1061.617380   1060.602905   957  0   16   1.8  1    FANLAGLLSR
716   477.231882   952.449212   952.464783   -16.35  1   16   1.7  1    SMKGQTTGK + Oxidation (M)
550   434.766207   867.517862   867.517792   0.08  0   16   1.1  1    LSPVISPR
1220   644.860000   1287.705448   1286.712875   771  1   16   3.2  1    MVALVRSDGALR
616   448.213987   894.413422   894.419540   -6.84  0   16   1.7  1    GGPGEPEPR
666   462.268337   922.522122   921.521835   1085  0   16   1.7  1    HLVLMGPR
605   443.265019   884.515486   884.533112   -19.93  0   16   2  1    TVLQLPSK
652   458.787374   915.560196   914.554871   1099  2   16   1.9  1    SKKALANAL
493   421.758331   841.502110   841.490921   13.3  0   16   1.6  1    VLSPPTTK
381   373.213166   744.411780   743.407852   1350  0   16   5.3  1    WIGVNR
593   440.731309   879.448066   878.432022   1157  0   16   3.2  1    MWLGTSGK
886   523.284955   1044.555358   1044.549805   5.32  1   16   4.3  1    RQEAMAALR
685   470.271772   938.528992   938.543686   -15.66  0   15   1.5  1    IDVPTLGPK
491   421.758294   841.502036   841.502121   -0.10  1   15   1.7  1    KELSLPR
1203   635.829548   1269.644544   1268.636063   795  1   15   2.8  1    STTEYAASVKGR
350   360.206664   718.398776   717.402100   1389  0   15   4.7  1    TLTVER
1480   573.631952   1717.874028   1717.882111   -4.71  0   15   3.7  1    INDAIADQMALFIQR
1188   422.259987   1263.758133   1262.745895   802  1   15   0.73  1    REAVGVLVAPPR
333   352.172635   702.330718   701.316650   1446  0   15   1.3  1    MHTGEK
762   490.773532   979.532512   978.513412   1041  1   15   2.6  1    NYQKDLAK
947   539.818161   1077.621770   1076.609070   941  0   15   2  1    LTHPNVVAAR
1440   832.402671   1662.790790   1661.781799   607  0   15   2.9  1    SEDAEVLDATPSGIMK
584   437.236845   872.459138   872.457825   1.50  1   15   3.4  1    KMYIFR + Oxidation (M)
760   490.285658   978.556764   978.561050   -4.38  0   15   2.3  1    NVNPVALPR
1402   511.932542   1532.775798   1532.776932   -0.74  2   15   4.1  1    TSKRGSLHFIEQM
953   542.807526   1083.600500   1082.601868   922  2   15   2.3  1    IKGQPCPKR
410   391.212408   780.410264   780.395233   19.3  1   15   2.5  1    RQSMLF
738   483.759857   965.505162   964.497787   1044  0   15   3.1  1    TVAVAEYGR
878   522.769132   1043.523712   1042.526962   956  1   15   2.9  1    FDLMYAKR
921   534.275655   1066.536758   1066.546097   -8.76  1   15   3.1  1    RFTFGFHR
1295   691.351495   1380.688438   1379.684021   728  2   15   3.7  1    MEHPSSPRGARR
1394   743.434890   1484.855228   1483.860947   670  1   15   1.8  1    LNVSKALEAALVEK
595   441.773763   881.532974   881.533432   -0.52  0   15   1  1    LLPSLSPR
837   513.320659   1024.626766   1024.625381   1.35  1   15   0.84  1    RVQTRPLR
736   482.767812   963.521072   962.529739   1030  1   15   3.5  1    YGAEIVRR
1441   834.877990   1667.741428   1667.749420   -4.79  2   15   1.4  1    KMKLEASQQNSEEM + Oxidation (M)
1163   622.346119   1242.677686   1241.680176   803  0   15   3.9  1    IVHILNMTSAK + Oxidation (M)
318   338.193051   674.371550   673.369354   1488  1   15   6.8  1    VPRMR + Oxidation (M)
751   488.276446   974.538340   974.550858   -12.84  2   15   4.7  1    KTSNKELR
820   509.802973   1017.591394   1016.576691   998  1   15   2.7  1    FSAKGLAPAR
1176   625.822455   1249.630358   1249.630249   0.09  0   15   3.8  1    SFDALLDNLSR
669   463.768925   925.523298   925.509338   15.1  1   15   2.2  1    LDPAARGAR
639   456.250454   910.486356   909.466797   1121  0   15   2.4  1    AEINAHQK
830   512.280236   1022.545920   1021.530502   994  0   15   3.5  1    GPPPQSVAGGR
506   424.753080   847.491608   846.481049   1194  2   15   2.8  1    KSKEIDK
661   461.279102   920.543652   920.530411   14.4  1   15   1.8  1    RHIATAPR
737   483.759857   965.505162   964.509033   1033  0   15   3.4  1    SQGPQVPPR
706   474.279973   946.545394   946.549438   -4.27  2   15   3.3  1    RTRLMVR + Oxidation (M)
565   435.755700   869.496848   869.508286   -13.15  0   15   1.9  1    VVQANALR
1156   615.313356   1228.612160   1227.593094   830  1   15   3.4  1    MQGHFPAERR
480   419.736039   837.457526   837.445663   14.2  2   15   2.5  1    SEYRKR
472   415.253711   828.492870   827.497696   1203  1   15   4.3  1    AAAIARQK
1563   571.084567   2850.386455   2849.332581   370  0   15   3.3  1    AVLSIDYYNMFTSIFTLTMMSVDR + 2 Oxidation (M)
1545   738.041062   2211.101358   2210.060608   471  1   15   3.9  1    KSGSTGNICSVMLNVATGCVR
1323   705.890818   1409.767084   1408.738403   730  2   15   2.8  1    NKEITKCLEFK
819   509.802937   1017.591322   1017.585861   5.37  1   15   2.9  1    GFKELPSIK
708   474.290426   946.566300   945.554184   1070  2   14   1.9  1    MKLSGVRR
1496   349.184760   1740.887420   1739.902679   566  1   14   4  1    TAASGARSRPEPGTQVR
671   464.249905   926.485258   926.482132   3.37  0   14   2.9  1    EGLPSAPTR
1447   840.400070   1678.785588   1677.780533   599  0   14   3  1    EALSNDTTESLAANSR
876   522.769132   1043.523712   1043.535950   -11.73  0   14   3.5  1    QQIGENLSR
726   479.781575   957.548598   957.549484   -0.93  0   14   4.6  1    SLPGLASSVK
384   375.201330   748.388108   747.387497   1339  0   14   5  1    SSLASQR
606   443.265186   884.515820   883.523941   1123  1   14   2.7  1    QVSKGLPR
1155   615.303936   1228.593320   1228.587021   5.13  1   14   3.2  1    KVSGTMYNTGR + Oxidation (M)
494   421.759095   841.503638   841.502121   1.80  1   14   2.2  1    ELKSIPR
750   488.271013   974.527474   974.539642   -12.49  0   14   5.5  1    ALDSITSIR
740   484.250995   966.487438   965.483139   1040  0   14   3.5  1    EHPPPHPR
956   542.807526   1083.600500   1083.589920   9.76  0   14   2.9  1    LFPGHCILK
610   447.263432   892.512312   891.515106   1119  1   14   2.7  1    RRPGPGPR
1250   659.312713   1316.610874   1316.613815   -2.23  1   14   2.3  1    MGISASTMTMKK + 2 Oxidation (M)
1452   841.932726   1681.850900   1680.837234   603  0   14   4.2  1    APHPFGVPAPSAGAYSR
707   474.290426   946.566300   945.560715   1063  2   14   2  1    KKIDSTVR
889   523.303227   1044.591902   1043.594788   955  2   14   4.8  1    RSALSAGARR
816   507.289503   1012.564454   1012.566544   -2.06  0   14   2.7  1    NLVDAGGVLR
1261   668.336342   1334.658132   1333.665970   744  1   14   4.8  1    SNIRDNVEMIK + Oxidation (M)
647   457.264041   912.513530   912.502869   11.7  0   14   2.6  1    LNSVEPVR
406   389.209458   776.404364   776.400314   5.22  1   14   5.6  1    MHFAKK + Oxidation (M)
690   471.782693   941.550834   941.554550   -3.95  0   14   2.9  1    QIAQEIIK
765   491.795368   981.576184   980.587936   1008  2   14   1.7  1    RKVVNTHK
1353   481.282998   1440.827166   1440.830032   -1.99  1   14   2.5  1    LSVEDAVKVGLVGR
378   371.197466   740.380380   739.368683   1368  0   14   1.9  1    MYGTLR
1482   860.436793   1718.859034   1718.887253   -16.42  1   14   4.8  1    ELTGDMQLSKSEILR
1255   663.293116   1324.571680   1324.545258   19.9  0   14   1.2  1    NGSEADMDTIEK + Oxidation (M)
906   530.252728   1058.490904   1058.506622   -14.85  0   14   2  1    MEPVQQAEK
744   484.787659   967.560766   967.556290   4.63  1   14   2  1    GLRGLEAPR
376   370.735497   739.456442   739.470444   -18.94  0   14   1.3  1    QKPVLR
1180   628.335900   1254.657248   1253.672775   785  1   14   4.4  1    ELKGHVISESR
1022   567.297997   1132.581442   1131.595779   871  0   14   5.5  1    ILDELTLCR
693   471.791705   941.568858   941.565796   3.25  1   14   3  1    IQLVKDAR
1470   849.445958   1696.877364   1696.874390   1.75  2   14   4.9  1    SPSPKKPLSDKDGEGR
339   357.235612   712.456672   711.439133   1430  1   14   1.7  1    RKPPSK
371   368.719899   735.425246   734.418762   1370  1   14   3.2  1    FGRTVR
397   382.219968   762.425384   761.421768   1318  1   14   5.1  1    AMAKGLR + Oxidation (M)
1067   581.327258   1160.639964   1159.619690   880  0   14   4.9  1    LLGSASPSSSVR
1370   729.414822   1456.815092   1455.793289   702  2   14   4  1    IGTKSKDLPSGPEK
541   865.495575   864.488299   863.472565   1176  1   14   3  1    RIHADPR
563   435.755700   869.496848   869.508286   -13.15  0   14   2.4  1    VVQANALR
386   375.709548   749.404544   749.418411   -18.50  0   14   4.9  1    HLDPIR
1055   576.780013   1151.545474   1151.524063   18.6  2   14   3.7  1    KSMDDQEKR + Oxidation (M)
659   461.279102   920.543652   920.541641   2.18  2   14   2.4  1    RRSHLPR
469   415.223368   828.432184   827.432327   1208  2   13   3.6  1    RMSKYK + Oxidation (M)
451   411.228961   820.443370   819.427261   1240  0   13   5.6  1    MLGQSIR + Oxidation (M)
1018   564.820094   1127.625636   1127.641068   -13.69  2   13   4.6  1    KLQKQEQAR
1179   628.335900   1254.657248   1253.647644   805  1   13   4.8  1    DHSRILVGDSR
281   316.180717   630.346882   629.349670   1585  0   13   7.2  1    TLGSPR
1116   600.332974   1198.651396   1197.625443   857  0   13   5.1  1    ALVSAGNPGAWR
995   558.306207   1114.597862   1113.604309   892  1   13   5.6  1    RNSIAGFPPR
779   494.294630   986.574708   985.566864   1023  1   13   5.1  1    LSDRGGLLR
426   399.245787   796.477022   795.475525   1259  2   13   1.5  1    KRFAFK
313   336.705212   671.395872   671.407837   -17.82  1   13   5.5  1    GAAGKIR
1454   842.438014   1682.861476   1682.888596   -16.12  2   13   4.7  1    HDASALDIRMGTLKR
625   449.771225   897.527898   896.507965   1138  0   13   2.4  1    TAVLSPGPR
449   411.222451   820.430350   820.436417   -7.39  0   13   5.6  1    SMLETIK
1363   723.365859   1444.717166   1444.741806   -17.05  1   13   5.1  1    TTVTMSMHLLPKA + Oxidation (M)
1024   567.329678   1132.644804   1132.635269   8.42  1   13   4.3  1    RYAVIGADLR
463   413.247494   824.480436   823.466415   1231  1   13   2.4  1    KAGAAGPPR
395   382.219756   762.424960   761.421768   1318  1   13   6  1    MSQIKR
419   396.199216   790.383880   790.382950   1.18  1   13   4.6  1    MMTKHK + Oxidation (M)
603   442.763545   883.512538   883.506165   7.21  1   13   2.6  1    MRHSLLK
675   465.777218   929.539884   928.520218   1098  2   13   6.3  1    AKQERAAR
637   454.763151   907.511750   907.501450   11.3  1   13   3.7  1    KLLEDYK
1541   737.706601   2210.097975   2209.057251   471  0   13   5.7  1    GTEEVFQALEDNQVALSTMK
638   455.248232   908.481912   908.478958   3.25  1   13   4.6  1    AFMSKTPK
885   523.284955   1044.555358   1044.535233   19.3  1   13   7.6  1    LWDVRDNK
1205   424.867683   1271.581221   1271.596848   -12.29  1   13   2.6  1    DNFMQQKAFK + Oxidation (M)
769   492.284871   982.555190   982.544739   10.6  0   13   2.9  1    LDSSLPPVR
1439   832.402671   1662.790790   1662.799515   -5.25  1   13   5  1    MSKVISAASGGQDQER
964   545.316699   1088.618846   1088.612427   5.90  1   13   5.7  1    INTLGRMIR + Oxidation (M)
758   490.267677   978.520802   977.508316   1036  0   13   6  1    GFFQGGIPR
1469   849.445957   1696.877362   1696.900879   -13.86  2   13   6.1  1    KTFSEKSSLIHHQR
1597   571.009893   3990.018319   3990.078522   -15.09  2   13   3  1    SSSELLSKPLTVVYKSLHDLSCYIFHSRSRPDLR
829   512.271042   1022.527532   1021.530472   976  1   13   5.7  1    AEHDPLKGR
799   500.797860   999.581168   999.572617   8.55  2   13   6  1    GGAGKIWRR
1112   599.240368   1196.466184   1195.460144   842  1   13   0.3  1    MMMMSMMKK + 3 Oxidation (M)
396   382.219840   762.425128   761.421768   1318  1   13   6.3  1    MSQIKR
958   544.290235   1086.565918   1086.555664   9.44  0   13   7  1    QLEAQLEEK
464   414.761364   827.508176   827.522888   -17.78  0   13   4.5  1    ALTVGLVR
773   492.771082   983.527612   982.542053   1003  1   13   4.1  1    RPGTRSGPR
467   414.761825   827.509098   826.491241   1232  0   13   4.4  1    LETLPVR
459   413.225603   824.436654   824.450439   -16.72  0   13   4  1    GPPALGASR
1404   515.300070   1542.878382   1542.898087   -12.77  1   13   3.3  1    SLLKETLDISVGLR
559   435.251149   868.487746   868.487885   -0.16  1   13   3.2  1    PVRSSAPR
1481   573.631952   1717.874028   1716.839249   603  0   13   7  1    DLDNMAFPQALPLEK + Oxidation (M)
620   448.258789   894.503026   893.498398   1124  1   13   3.5  1    VAHRFHK
911   531.759760   1061.504968   1060.515762   933  0   13   5.1  1    TMLHSLMGR + Oxidation (M)
530   428.766205   855.517858   855.529007   -13.03  1   13   3.3  1    IAQKQIR
990   556.306397   1110.598242   1109.590286   908  1   13   4.6  1    IFSLMKEAR + Oxidation (M)
950   540.329891   1078.645230   1078.661087   -14.70  2   12   1.8  1    NNLVKHVKK
711   475.778228   949.541904   948.539261   1057  0   12   4.1  1    TAVIGAVYR
712   476.768024   951.521496   950.518524   1055  0   12   4.9  1    NFITLTSR
546   434.759087   867.503622   867.517792   -16.33  0   12   2.9  1    LAPPTTIR
1084   585.288540   1168.562528   1167.559418   859  0   12   5.1  1    LFSCGADGTLK
468   415.223368   828.432184   828.427597   5.54  0   12   4.6  1    IHGSMLR + Oxidation (M)
778   494.294630   986.574708   985.566849   1023  1   12   6.3  1    LERPRTSK
613   447.755605   893.496658   893.483139   15.1  0   12   4.4  1    QPGRPSPR
688   470.783718   939.552884   939.540253   13.4  1   12   2.4  1    RLNWVPR
952   542.256754   1082.498956   1081.500824   923  1   12   3.6  1    DASLMAMRR + 2 Oxidation (M)
1218   643.341226   1284.667900   1283.672150   776  0   12   5.5  1    DIPGLTDTTVPR
803   501.290003   1000.565454   999.571274   995  1   12   7.4  1    IEKRPLSTG
566   435.755700   869.496848   869.485809   12.7  0   12   3.3  1    LLEPALSQ
532   432.252586   862.490620   861.496017   1155  0   12   5.4  1    LTTPVFGK
1064   581.326977   1160.639402   1159.646164   857  2   12   7  1    SIHKRSFSAK
925   534.753055   1067.491558   1067.503616   -11.30  0   12   3.4  1    GQDPGAQPWL
462   413.238068   824.461584   823.455185   1222  0   12   3.9  1    NIVEPPR
1223   647.366527   1292.718502   1291.691788   795  2   12   4.7  1    MIASIKSQKDR + Oxidation (M)
483   421.253599   840.492646   839.486496   1199  0   12   3.2  1    SLTPLPGR
501   423.275271   844.535990   843.529007   1194  2   12   2.7  1    KSRLVNK
1085   586.833415   1171.652278   1171.631775   17.5  1   12   7.9  1    MRMISHIIR + Oxidation (M)
285   316.682444   631.350336   630.344910   1595  0   12   10  1    SQIQR
905   528.763593   1055.512634   1055.524719   -11.45  0   12   4.4  1    ALDAISHSDK
601   442.763484   883.512416   883.512711   -0.33  0   12   3.2  1    TLGDLIPR
626   449.782236   897.549920   897.546982   3.27  0   12   2.3  1    IMLPGVLR
800   500.797860   999.581168   998.562103   1021  1   12   6.8  1    IEAGIRGAGR
243   574.306875   573.299599   572.291824   1761  0   12   3.6  1    DVPSR
439   406.220922   810.427292   809.428299   1234  1   12   4.4  1    TSPKYSK
600   442.763484   883.512416   882.514755   1130  2   12   3.2  1    RRGELPR
1271   673.813170   1345.611788   1345.618378   -4.90  0   12   2.9  1    SADCSVPSPALDK
783   496.303352   990.592152   989.584412   1018  2   12   2.5  1    MWKILRK + Oxidation (M)
1040   573.306357   1144.598162   1144.616180   -15.74  1   12   8.1  1    VEMPSLKTPK + Oxidation (M)
551   434.766217   867.517882   867.517776   0.12  0   12   2.6  1    APELALVR
983   553.828985   1105.643418   1105.638290   4.64  1   12   3.4  1    LIETDFKIK
891   523.303238   1044.591924   1043.572342   977  0   12   7.7  1    NSASVGIIQR
746   487.789977   973.565402   972.560394   1033  1   12   6.6  1    RLVITTSPS
927   535.281221   1068.547890   1067.543350   941  0   12   5.7  1    MTPPVANPNK
1462   846.440707   1690.866862   1690.871246   -2.59  0   12   8.3  1    NLLFSGSPAVTMTPTR
1047   575.842160   1149.669768   1148.658691   880  2   12   3.2  1    KSLKMSLQAK + Oxidation (M)
1460   846.440705   1690.866858   1689.829681   614  1   12   8.4  1    MPPAQGYEFAAAKGPR
907   530.748400   1059.482248   1058.474945   952  1   12   2.6  1    MENPRCPR
592   440.731309   879.448066   879.448380   -0.36  1   12   7.4  1    MAASGKTSK
329   347.208303   692.402054   691.390457   1463  0   12   4.2  1    GILYLN
1207   636.798031   1271.581510   1271.592346   -8.52  1   12   3.4  1    ISTGMMMKETK + Oxidation (M)
1487   864.450290   1726.886028   1725.906296   568  1   12   7.4  1    RYPPAYGPDGKPRPR
887   523.292092   1044.569632   1043.561096   966  0   12   9.1  1    IQEAASQGLK
454   412.746100   823.477648   823.466400   13.7  1   12   3.5  1    GHAKAAAAK
805   501.290196   1000.565840   999.550156   1016  1   12   8.7  1    DPAKAFVPR
676   465.777284   929.540016   928.534164   1083  0   12   8.4  1    LSLVPSSAR
326   346.706551   691.398550   690.384659   1469  1   12   5.8  1    MGLSRK
479   419.736039   837.457526   836.450439   1204  0   12   4.8  1    GPSPPLNR
656   459.279675   916.544798   915.538925   1099  0   12   5.2  1    LDVISTLR
359   723.438028   722.430752   722.418747   16.6  0   12   1.9  1    TRPPPR
387   377.232893   752.451234   752.454453   -4.28  0   12   2.5  1    LAPLPSR
966   545.316699   1088.618846   1088.634186   -14.09  1   12   7.5  1    KLYSIAAPAR
609   443.739970   885.465388   885.478043   -14.29  1   12   5.7  1    RGEAQGLR
1206   636.798031   1271.581510   1270.583649   785  0   12   3.6  1    GESTRPHNMAR + Oxidation (M)
1350   720.404344   1438.794136   1438.819061   -17.32  1   12   5.3  1    QMSLLLRRPPGR + Oxidation (M)
460   413.225603   824.436654   824.421448   18.4  0   12   5.2  1    YLLMGGR + Oxidation (M)
1017   564.820094   1127.625636   1126.628067   885  1   12   7.1  1    RAPLLLECR
818   507.800168   1013.585784   1013.598129   -12.18  2   12   6.4  1    ARAQAEIKK
1136   611.355882   1220.697212   1219.703674   815  2   12   4.5  1    KRYDLSALVR
1269   672.408851   1342.803150   1341.797958   749  2   12   2.4  1    RDAISLAIKDIK
282   316.180743   630.346934   630.344925   3.19  1   12   11  1    AGLGRGT
570   435.773736   869.532920   869.544678   -13.52  1   12   3.4  1    QVLGGLRK
801   501.289951   1000.565350   999.546127   1020  2   12   9.2  1    SGPPSKSGKR
1509   913.982278   1825.950004   1825.952209   -1.21  2   12   7.4  1    RGMSVWLPSPAGAWRR
888   523.303120   1044.591688   1043.583572   966  2   12   8.6  1    RSSLSPGRGK
903   528.763592   1055.512632   1055.524734   -11.47  0   12   5  1    TSEHQVDLK
482   421.242821   840.471090   840.481750   -12.68  1   12   4.5  1    VKSGTPPR
465   414.761825   827.509098   826.491241   1232  0   12   5.8  1    LETLPVR
682   468.713159   935.411766   935.420456   -9.29  0   12   3  1    AAMDAVCAK
536   432.748498   863.482444   863.472580   11.4  2   11   6.7  1    RGFGSGKR
640   456.771829   911.529106   910.534836   1092  1   11   3.6  1    NIQGKVPR
453   412.746049   823.477546   822.482422   1210  1   11   3.8  1    HGVQVKR
1417   796.323239   1590.631926   1590.636154   -2.66  0   11   0.39  1    YYNPFEEEEEDK
448   411.222416   820.430280   819.433777   1216  1   11   8.5  1    DTSEKLK
264   300.700464   599.386376   598.380234   1681  0   11   6.7  1    ITIPR
764   491.795368   981.576184   980.587921   1008  1   11   3.1  1    ARPKVPASR
929   535.786386   1069.558220   1069.576752   -17.33  0   11   6.6  1    SHSSLEGLLK
985   553.829716   1105.644880   1105.649536   -4.21  1   11   4  1    LGTKGIIPNPP
980   553.295804   1104.577056   1103.594818   890  1   11   11  1    HGGSLVNHRK
424   398.214594   794.414636   794.428650   -17.64  0   11   6.1  1    YISGTVR
425   399.240542   796.466532   796.455536   13.8  0   11   2.6  1    QGPLGAVR
922   534.293541   1066.572530   1065.581848   930  1   11   6.7  1    SKDITSLFR
1345   480.239660   1437.697152   1436.675674   711  1   11   7.6  1    EYRTLGGGGGGGSGGR
798   500.225516   998.436480   998.435226   1.26  0   11   2.1  1    QHQVCGDR
881   523.274142   1044.533732   1044.542435   -8.33  1   11   9  1    RGAAGGNLSSR
1466   566.631633   1696.873071   1696.899521   -15.59  2   11   8.7  1    IKVEPASEKDPESLR
417   396.198887   790.383222   790.393311   -12.76  1   11   7  1    SSEGRQK
276   623.355324   622.348048   622.343826   6.78  1   11   5.2  1    AYNKK
265   603.348002   602.340726   601.343506   1658  1   11   13  1    KEPTK
599   442.763484   883.512416   883.512711   -0.33  0   11   4  1    QQGPILTK
1010   562.342610   1122.670668   1122.654953   14.0  2   11   2.1  1    FRTPSFLKK
471   415.253671   828.492790   828.492981   -0.23  1   11   9.5  1    IGRAGTVR
375   370.735497   739.456442   738.438812   1378  0   11   2.5  1    SPPGLLR
1524   977.449959   1952.885366   1952.919662   -17.56  0   11   4.5  1    TQGGASNPALQIGSHPMCK
515   426.245816   850.477080   849.470840   1185  2   11   5.4  1    NISKKFGG
580   436.774624   871.534696   871.523911   12.4  2   11   7.8  1    KARAGEIK
602   442.763485   883.512418   882.503510   1143  1   11   4.2  1    ALPERAAR
718   477.261239   952.507926   952.522934   -15.76  0   11   6  1    SVSYSILGK
1052   384.581930   1150.723962   1150.718613   4.65  1   11   0.91  1    LRVDIAVPLR
1510   913.982278   1825.950004   1824.940353   553  0   11   8.4  1    DLKPENIMLSSQGHIK + Oxidation (M)
1201   635.343538   1268.672524   1268.654709   14.0  0   11   7.6  1    MAEVVSPVPGAGR
1351   720.404344   1438.794136   1438.775269   13.1  2   11   6.1  1    RAEAAGRQSQPLR
1058   578.319587   1154.624622   1153.616516   874  0   11   6.5  1    VYLGLSSMLR + Oxidation (M)
1109   597.856379   1193.698206   1192.704025   834  1   11   3.3  1    ALLSRGPVPGAR
924   534.293787   1066.573022   1065.556702   954  1   11   7.3  1    TDSRGYLVR
770   492.284872   982.555192   982.538193   17.3  1   11   4.7  1    HGLKMLER
233   561.282651   560.275375   559.271408   1795  0   11   8.9  1    GAEGAR
1486   861.485359   1720.956166   1719.967209   575  1   11   5.6  1    KVTVDLQPVWPPVSR
1463   846.440710   1690.866868   1689.883850   582  2   11   11  1    YYVDSVKGRFTISR
373   369.221119   736.427686   735.431274   1355  2   11   3.3  1    KMSKVK + Oxidation (M)
500   423.227185   844.439818   844.451477   -13.81  1   11   11  1    AIRENSR
1516   918.918280   1835.822008   1834.816284   548  1   11   5.6  1    QGTGRCSGASPCVSGAQR
1548   742.378529   2224.113759   2224.080215   15.1  2   11   10  1    IEHEHEGCLKMSPASLMKK
1141   407.906443   1220.697501   1219.682571   832  1   11   5.5  1    HKVLWDPVAR
581   436.774624   871.534696   870.539902   1143  2   11   8.5  1    EALRKVR
839   514.297959   1026.581366   1025.575699   981  1   11   6.2  1    ALKSVIDSPP
511   425.760842   849.507132   849.507217   -0.10  1   11   4.2  1    LKSSFLR
1512   609.998240   1826.972892   1825.960724   554  1   11   8.4  1    AAELGHELSMEILAKAK + Oxidation (M)
284   316.192652   630.370752   630.381287   -16.71  1   11   22  1    KLGASR
392   382.188537   762.362522   761.360245   1316  1   11   9.1  1    MGRGGER
1232   652.768225   1303.521898   1303.540421   -14.21  0   11   0.87  1    SYSFWGGQGCR
734   482.302215   962.589878   961.593338   1036  1   11   2.4  1    RAPLPRPR
1071   583.337728   1164.660904   1164.661499   -0.51  0   11   5.8  1    TPLRPLDPTR
1451   841.430158   1680.845764   1680.837234   5.07  0   11   11  1    APHPFGVPAPSAGAYSR
1187   631.352430   1260.690308   1259.694580   790  2   10   11  1    DITSAVQSKRR
634   451.768784   901.523016   900.502869   1133  0   10   13  1    LDVQLASR
724   479.277171   956.539790   956.529083   11.2  0   10   9.3  1    EVPSSAVLR
342   357.697252   713.379952   713.378189   2.47  0   10   4.8  1    GLPAMPL + Oxidation (M)
608   443.272366   884.530180   883.523956   1139  1   10   6.6  1    VTGPQKVR
575   435.775039   869.535526   869.548706   -15.16  1   10   3.9  1    VVKFLHK
1333   712.830826   1423.647100   1423.666016   -13.29  1   10   5.8  1    MRSGGGCSGSLSLR
1453   842.438014   1682.861476   1682.847519   8.29  0   10   9.4  1    EYITSSLVQQVSSSR
677   465.777284   929.540016   928.520233   1098  1   10   12  1    GARLAAAGSR
611   447.263432   892.512312   891.492630   1144  0   10   6.5  1    HLPDLAAR
763   491.302000   980.589448   979.570206   1040  1   10   3.1  1    SSIKISAFK
1488   864.450290   1726.886028   1725.891037   577  2   10   11  1    YSGRTQRQLLEYGR
578   436.274885   870.535218   870.528687   7.50  1   10   6.4  1    ELGLVKGR
814   506.324016   1010.633480   1010.634872   -1.38  1   10   2  1    RTLIRPAGK
840   514.799633   1027.584714   1026.582153   977  1   10   9.1  1    LKEAPNISR
393   382.219756   762.424960   761.414368   1327  2   10   12  1    ERKSSR
916   531.816533   1061.618514   1060.602905   958  0   10   6.5  1    FALNSLLQR
981   553.828923   1105.643294   1104.640350   908  1   10   5.8  1    ALAPLRDPPR
643   457.251025   912.487498   911.487167   1097  2   10   7.9  1    RQKMGHR
1270   672.408851   1342.803150   1341.786713   758  1   10   3.3  1    IAESILKEAQIK
1446   840.400070   1678.785588   1678.770767   8.83  2   10   7.9  1    FASLSXKMXSRLSSK + Oxidation (M)
949   540.329879   1078.645206   1078.665115   -18.46  1   10   3.1  1    LIRVIFYR
678   467.269206   932.523860   932.519196   5.00  0   10   12  1    SVVRPGYR
681   468.254664   934.494776   934.490601   4.47  0   10   14  1    SCTSVILR
330   696.380485   695.373209   695.360245   18.6  0   10   6.2  1    GTVTYR
850   516.313475   1030.612398   1029.629440   955  2   10   6.6  1    IQAKSKSLR
232   558.306207   557.298931   556.296906   1801  0   10   3  1    IPDGR
547   434.759092   867.503632   866.512634   1144  1   10   5.2  1    ILRYFR
349   360.206664   718.398776   717.402084   1389  0   10   17  1    LTSLER
795   498.803153   995.591754   994.581146   1016  0   10   3.4  1    GGTLGPVPLGK
1551   462.415012   2307.038680   2307.068878   -13.09  1   10   5.5  1    SSPEADLTMEKITVESDHFR + Oxidation (M)
1038   572.806465   1143.598378   1142.586624   885  1   10   13  1    REICGAPGVGK
262   300.198786   598.383020   598.380234   4.66  0   10   3.7  1    TIIPR
555   435.251088   868.487624   868.487885   -0.30  1   10   6  1    SPIRGSPR
1430   539.984765   1616.932467   1616.936218   -2.32  1   10   4.2  1    AKVTLNGVPAQPLGPR
562   435.752986   869.491420   869.508286   -19.40  0   10   6.1  1    VVQANALR
328   692.406822   691.399546   691.401718   -3.14  0   10   10  1    GTFLVR
1471   849.445958   1696.877364   1695.847488   607  1   10   12  1    SVRCIQPLHDNTTR
848   516.313475   1030.612398   1029.597107   986  0   10   6.9  1    QTLPPPLHK
986   553.829721   1105.644890   1105.624374   18.6  1   10   5.6  1    KRPTSAVGYK
1485   861.445950   1720.877348   1719.901627   567  1   10   13  1    SNLTTHQVIHTGEKR
720   478.784849   955.555146   954.535889   1068  1   10   7.2  1    IRLSHSSR
946   539.818161   1077.621770   1077.611710   9.34  1   10   7  1    MARVFSVLR
358   362.222383   722.430214   722.418747   15.9  0   10   3  1    GHALAVR
998   559.314069   1116.613586   1115.612091   898  0   10   14  1    QQIAMSAIVR
1183   628.382111   1254.749670   1254.752045   -1.89  2   10   5  1    NRVVQSGIKVR
596   441.773763   881.532974   880.542221   1125  0   10   3.5  1    IVVLFYK
960   544.290380   1086.566208   1086.586212   -18.41  0   10   14  1    TLYFFIAGR
538   433.235355   864.456158   863.453461   1161  1   10   12  1    TMSIKER
591   440.258510   878.502468   877.488205   1156  1   10   7.8  1    EHRIAPR
951   540.329897   1078.645242   1077.629456   943  0   10   3.4  1    LAGLHDAILR
508   425.204740   848.394928   848.399658   -5.58  0   10   8.8  1    MAALGCAR
1365   482.959367   1445.856273   1444.832947   708  1   10   3.3  1    IIYSAKLSFLYK
273   307.175265   612.335978   612.345581   -15.68  1   10   5.7  1    APRGGR
526   428.261355   854.508158   854.497375   12.6  0   10   4.9  1    NKPVELR
664   462.238145   922.461738   921.441193   1108  1   10   10  1    KNMTGPMK + Oxidation (M)
1089   589.342763   1176.670974   1175.644440   873  2   10   8.1  1    RLITMEKNR + Oxidation (M)
1432   542.585828   1624.735656   1624.760254   -15.14  1   10   6.5  1    MWIMTRTWGGQAR + 2 Oxidation (M)
862   518.316705   1034.618858   1033.618500   968  1   10   4.1  1    RLLWPPPR
589   440.225099   878.435646   878.427994   8.71  0   10   11  1    CSSSVAIR
1239   437.257153   1308.749631   1308.730896   14.3  1   10   6.1  1    MRPAAGAARRPR
391   379.710892   757.407232   756.412994   1314  0   10   9.6  1    SLLGDPR
1124   606.368850   1210.723148   1210.707397   13.0  1   9   4.4  1    VRLTFFTLSK
573   435.773790   869.533028   868.513031   1174  1   9   5.4  1    VPQKELR
619   448.258786   894.503020   894.499695   3.72  1   9   7.2  1    CFKSLLK
832   512.280712   1022.546872   1021.526443   999  2   9   11  1    SSRSTRSNK
363   363.219073   724.423594   724.411926   16.1  0   9   5  1    SPSLPPK
461   413.238067   824.461582   823.443939   1236  1   9   7.4  1    SLAYDKK
1313   466.607758   1396.801446   1396.803772   -1.67  1   9   6.6  1    KPGSVVAAAAAEAKK
1157   619.868680   1237.722808   1237.707718   12.2  2   9   4.5  1    CLPAGRLPAKR
438   405.240505   808.466458   808.455505   13.5  2   9   6.4  1    YSGKARK
794   498.781027   995.547502   994.555984   997  0   9   8.6  1    VLATQPGPGR
1403   514.305160   1539.893652   1539.873230   13.3  2   9   5.2  1    IEAENRALILRDK
292   318.196596   634.378640   633.363190   1603  1   9   8  1    MSKIR
831   512.280712   1022.546872   1021.530502   995  0   9   12  1    GPPPQSVAGGR
263   300.199044   598.383536   598.380234   5.52  0   9   4.2  1    TIIPR
1185   630.859739   1259.704926   1258.676849   817  0   9   12  1    ITENSIVENLK
331   699.398963   698.391687   697.387131   1440  0   9   5.6  1    VHTSVR
341   714.378411   713.371135   712.361633   1417  0   9   6.2  1    GAPAGGAGR
781   494.300529   986.586506   986.576004   10.6  1   9   11  1    NKATAEILK
648   457.264137   912.513722   911.493698   1119  1   9   7.9  1    EPRGGQLR
452   412.746018   823.477484   822.471161   1224  2   9   6.4  1    KKFSASR
338   357.214432   712.414312   711.402771   1422  0   9   5.4  1    IHSTVR
1039   573.255184   1144.495816   1144.512238   -14.35  1   9   3.3  1    GGYDHGGRGGGR
234   562.342574   561.335298   560.335587   1784  0   9   7.1  1    MALVK
302   647.366527   646.359251   646.364975   -8.86  0   9   19  1    NTATIK
1277   677.395413   1352.776274   1351.786346   732  2   9   6.6  1    INLSKIDKFFK
504   423.736779   845.459006   844.465408   1177  0   9   23  1    LPTAASASK
618   448.258771   894.502990   894.492325   11.9  0   9   8  1    GTPPLTPGR
991   556.306405   1110.598258   1109.594131   905  0   9   10  1    SAQHSQALLR
1093   589.342937   1176.671322   1175.644455   873  1   9   9.4  1    MLSAASRVVSR
1491   579.308539   1734.903789   1734.873611   17.4  2   9   15  1    NQINFWRNQMTKR
1142   611.356109   1220.697666   1220.676483   17.4  0   9   8.1  1    VPSAGGPPVLAEK
1414   792.898025   1583.781498   1583.812805   -19.77  2   9   12  1    DGSHSLKVSQQRSR
1184   628.382111   1254.749670   1253.727783   815  2   9   6.1  1    MNKHVLKIQK + Oxidation (M)
1154   615.303936   1228.593320   1228.615982   -18.45  2   9   11  1    ENASEGKGPGKR
972   549.739606   1097.464660   1096.452881   923  0   9   3.3  1    AQNDVMEMK + 2 Oxidation (M)
1132   608.846607   1215.678662   1215.683640   -4.09  1   9   16  1    HVRAPTPSPVR
1354   481.282998   1440.827166   1439.798370   715  2   9   8.1  1    LKDDVPEEVKLR
1059   578.319587   1154.624622   1153.599243   889  0   9   11  1    HVAAGTAFPQR
537   864.489958   863.482682   862.475983   1167  1   9   12  1    SVDSSIKK
923   534.293787   1066.573022   1065.548813   961  2   9   12  1    AMATKAKSDK + Oxidation (M)
1344   480.239660   1437.697152   1436.704834   691  0   9   13  1    PWQTGTLGTSYAR
1029   567.329766   1132.644980   1131.628815   898  0   9   11  1    TVFTHLSSLK
629   450.274402   898.534252   898.523590   11.9  1   9   8.7  1    SVPLAEKR
935   537.300806   1072.587060   1071.582520   937  0   9   24  1    SLAVAHAAVHP
1081   584.355745   1166.696938   1165.693100   861  1   9   3.5  1    ALPGLLEARAR
1023   567.329678   1132.644804   1131.626114   900  2   9   12  1    FPGSLSRGRR
1102   597.375768   1192.736984   1191.745163   832  2   9   1.6  1    LKGKLPPGAGVR
642   456.771841   911.529130   911.518860   11.3  1   9   6.6  1    IPVDQGKR
1008   562.342587   1122.670622   1122.687302   -14.86  1   9   3.7  1    ALDLLRGLPR
797   498.803153   995.591754   994.581131   1016  0   9   4.5  1    AVILGPPGSGK
1015   564.296782   1126.579012   1125.559601   906  0   9   12  1    IITVMSMGMK + Oxidation (M)
646   457.264022   912.513492   912.502853   11.7  0   9   8.7  1    ALSPEGALR
984   553.829011   1105.643470   1105.649506   -5.46  1   9   7.3  1    LYLSKNQLK
597   441.787331   881.560110   881.544678   17.5  1   9   2  1    VPVRNLGK
1007   562.342574   1122.670596   1121.655685   905  0   9   3.7  1    VQATGPPALLR
1212   641.882045   1281.749538   1280.756454   775  1   9   5.3  1    TTPALLPLSGRR
433   404.232810   806.451068   805.447998   1245  1   9   13  1    MKLSGVR + Oxidation (M)
476   418.212010   834.409468   834.401794   9.20  1   9   14  1    MDRVGGGK + Oxidation (M)
982   553.828973   1105.643394   1104.621246   925  1   9   7.5  1    ELTINIKMK + Oxidation (M)
1391   495.958271   1484.852985   1484.860916   -5.34  2   9   8.7  1    NSRTMLLPLLRR + Oxidation (M)
450   411.222454   820.430356   819.416031   1238  0   9   16  1    MLSLIGGN + Oxidation (M)
569   435.773727   869.532902   869.523544   10.8  1   9   6.6  1    HAKVLFR
291   318.196595   634.378638   633.363190   1603  1   9   9.4  1    RIAMK + Oxidation (M)
957   544.290235   1086.565918   1086.564209   1.57  2   9   18  1    SRAEARQNR
1240   655.382270   1308.749988   1307.727142   782  0   9   7.5  1    MPPPTILSTVPR
1415   792.898025   1583.781498   1583.761353   12.7  1   9   14  1    CYDRDVSLSTGAIK
973   549.739606   1097.464660   1097.474625   -9.08  1   9   3.5  1    CEACGKAFR
1126   606.368862   1210.723172   1209.708130   839  0   9   5.5  1    VPGLTQAVQVAK
955   542.807526   1083.600500   1082.612411   913  1   9   11  1    QSLVAFYKK
1105   597.855275   1193.695998   1192.678864   853  1   9   6.2  1    HQLSLIRGNR
1053   576.369282   1150.724012   1150.707367   14.5  1   9   1.6  1    LLGPSKGAPLAK
1086   587.327156   1172.639760   1171.624390   867  2   8   19  1    MKRGTSLHSR
514   851.450000   850.442724   849.445694   1174  0   8   14  1    AGPQPPAGR
1490   865.495575   1728.976598   1727.968231   584  2   8   8.2  1    HSFSSQKVRLVIAEK
1260   667.315174   1332.615796   1331.631729   739  0   8   10  1    SLDSPTSSPGAGTR
466   414.761825   827.509098   826.513702   1204  2   8   12  1    NVLRRGL
617   448.257737   894.500922   893.508286   1111  1   8   9.4  1    KVSNPPPR
1401   510.633589   1528.878939   1528.875885   2.00  2   8   7.9  1    RLKGALMLENLQK + Oxidation (M)
539   433.235355   864.456158   864.456589   -0.50  0   8   16  1    GPASHLQR
828   511.326802   1020.639052   1020.633163   5.77  0   8   1.5  1    TLTVLHPLK
996   559.314069   1116.613586   1115.607376   902  0   8   20  1    IEEISPSTLK
1311   466.607758   1396.801446   1395.802017   716  1   8   8.5  1    LKPLAIGKCSGPR
1224   647.366527   1292.718502   1291.707047   783  2   8   11  1    GKAFKVMNELR
645   457.264013   912.513474   911.507629   1103  0   8   9.6  1    STHVVLEK
963   545.316636   1088.618720   1087.598557   938  0   8   16  1    GNAATLSLVSR
662   922.377082   921.369806   920.365753   1091  0   8   1.7  1    NEMENER
1442   834.877990   1667.741428   1667.721786   11.8  1   8   6.6  1    YDEMMELLRCHR + Oxidation (M)
948   540.329617   1078.644682   1077.640686   932  1   8   4.7  1    ALPPGLRAQR
564   435.755700   869.496848   868.487885   1162  1   8   8.4  1    PVRSSAPR
954   542.807526   1083.600500   1082.587280   936  0   8   11  1    IFQPTPPGAR
1297   692.325888   1382.637224   1382.623535   9.90  0   8   8.9  1    VTETEDTQMVSK + Oxidation (M)
317   338.192795   674.371038   673.354752   1509  0   8   32  1    AFPPSR
1193   633.368923   1264.723294   1264.699982   18.4  1   8   9  1    ASAPAAPRQGLAR
1590   571.117227   3420.659706   3420.706284   -13.62  1   8   12  1    DIPDPGPPGDQGPPGPDGPRGAPGPPGLPGSVDLLR
370   368.719887   735.425222   734.410873   1381  1   8   11  1    ALKMTR + Oxidation (M)
457   412.754134   823.493716   822.482407   1230  1   8   5.6  1    LQPRGPR
1443   834.877990   1667.741428   1667.760696   -11.55  1   8   6.8  1    KALSTQGSQTDMDMR
1177   626.298630   1250.582708   1249.568237   812  0   8   11  1    GNLIGEMAADIM + Oxidation (M)
1182   628.382111   1254.749670   1253.745529   801  1   8   7.2  1    LAVIARNLEGAK
516   426.246082   850.477612   850.494614   -19.99  2   8   10  1    KMKVTTK + Oxidation (M)
558   435.251145   868.487738   867.492645   1147  0   8   8.9  1    HGSVSLLR
1483   860.436793   1718.859034   1717.866821   578  1   8   18  1    MNALADALKSINNAEK + Oxidation (M)
1387   493.274549   1476.801819   1475.809143   673  1   8   17  1    MMVLKVEELVTGK
971   549.313411   1096.612270   1096.624039   -10.73  0   8   11  1    LALVNNTQPK
502   423.275271   844.535990   844.538177   -2.59  2   8   6.9  1    LTLKKDK
842   515.287704   1028.560856   1028.558746   2.05  2   8   18  1    RSRAGAGGAAR
679   467.300433   932.586314   931.570206   1091  1   8   2.8  1    TSLKAATIK
347   360.206551   718.398550   718.408585   -13.97  1   8   26  1    TTRVSR
1016   564.820094   1127.625636   1126.620682   892  2   8   16  1    ASRTKSPGPAR
389   379.248821   756.483090   756.485764   -3.53  0   8   12  1    LSVAVLR
841   515.287704   1028.560856   1028.540298   20.0  0   8   18  1    AAAPAFPAASR
1110   597.856426   1193.698300   1193.684174   11.8  1   8   6.5  1    YIMLEIKLR + Oxidation (M)
456   412.754132   823.493712   823.477661   19.5  1   8   5.8  1    SGRVLHR
594   441.245355   880.476158   880.476669   -0.58  0   8   11  1    GLPGVEGPR
1273   451.932424   1352.775444   1352.788788   -9.86  2   8   8.6  1    KNSSALHSLLKR
641   456.771841   911.529130   910.523605   1104  0   8   7.9  1    LPGIVAEGR
732   481.268893   960.523234   960.517456   6.02  1   8   22  1    SILNARCK
1083   584.355761   1166.696970   1166.681168   13.5  1   8   4.3  1    AFLVYGKLTR
1553   623.355324   2489.392192   2488.364426   413  1   8   4.3  1    QTIEILMNPILLVKNTSLSMSK + Oxidation (M)
161   474.290426   473.283150   472.275772   2133  0   8   28  1    AAGVR
987   553.829749   1105.644946   1105.660751   -14.29  2   8   8.8  1    RLKFNSTIK
441   406.248667   810.482782   809.487152   1230  1   8   5.2  1    RAPTPIR
703   472.287458   942.560364   941.540649   1083  2   8   16  1    TPAQGKRGK
379   371.197466   740.380380   740.392914   -16.93  1   8   7.7  1    RETHAK
915   531.816524   1061.618496   1061.601517   16.0  2   8   11  1    SLKGKLMNR + Oxidation (M)
1474   853.502231   1704.989910   1703.954300   608  2   8   4.7  1    RENHILASGSVRIPR
997   559.314069   1116.613586   1116.613876   -0.26  0   8   22  1    ALGVSLNATSGK
343   357.716138   713.417724   713.418381   -0.92  0   8   11  1    AAAAALAR
518   426.246093   850.477634   849.482056   1172  2   8   11  1    YKDLRR
1506   901.884404   1801.754256   1801.778839   -13.64  0   8   2.5  1    QSTEGSLEMETAFNSR + Oxidation (M)
674   465.284900   928.555248   927.561401   1071  1   8   18  1    GAVGRVLTR
1000   559.314072   1116.613592   1115.629852   882  1   8   22  1    TTLEVLRER
1095   589.374545   1176.734538   1176.720352   12.1  2   8   2.1  1    VRGVAPLRGPR
704   472.287459   942.560366   941.540649   1083  2   8   16  1    TPPTSRKR
757   490.267677   978.520802   978.535431   -14.95  1   8   19  1    MLSVKVMR + Oxidation (M)
849   516.313475   1030.612398   1030.628738   -15.85  0   8   11  1    VPLSHLPLR
217   535.285114   534.277838   534.276169   3.12  0   8   15  1    STATR
315   674.314304   673.307028   673.296600   15.5  0   8   3.4  1    GCGGPAR
548   434.759096   867.503640   867.515106   -13.22  1   8   8.6  1    IGGRGRPR
913   531.816142   1061.617732   1061.601532   15.3  1   8   11  1    RILMGSTLR + Oxidation (M)
1569   976.061084   2925.161424   2924.180008   336  0   8   0.56  1    GYYNQSEAGSHTIQMMYGCDVGPDGR + 2 Oxidation (M)
719   478.784842   955.555132   955.556305   -1.23  1   8   12  1    VADLVAGRR
398   383.200716   764.386880   763.389801   1306  0   8   17  1    ISEIMR + Oxidation (M)
524   428.261355   854.508158   854.497375   12.6  0   8   7.5  1    NKPVELR
745   487.292537   972.570522   972.560364   10.4  2   8   18  1    SSKKAEPVK
941   538.326808   1074.639064   1073.619293   950  1   8   9.1  1    LVKSGSLGSAR
1107   597.855306   1193.696060   1192.704025   832  2   8   7.7  1    KVPPARSVSPR
348   360.206554   718.398556   717.409485   1379  0   8   29  1    ISICLL
401   384.235567   766.456582   765.449722   1315  0   8   8.1  1    LPPGAGVR
807   502.813566   1003.612580   1003.606613   5.95  0   8   6.7  1    VPLSPLPGPK
1349   480.604630   1438.792062   1437.772873   709  0   8   14  1    GHLVLTPFGIGDGR
1296   692.325888   1382.637224   1382.638779   -1.12  0   8   10  1    EQSEVGSMGALLF + Oxidation (M)
974   550.243724   1098.472896   1098.479767   -6.26  1   8   4.6  1    MKDSNSMVR + 2 Oxidation (M)
755   489.313867   976.613182   975.597748   1041  2   8   2.7  1    KIRYQLR
1075   583.376536   1164.738520   1164.734253   3.66  1   8   1.3  1    VNVPLNIIRK
938   537.300812   1072.587072   1072.569885   16.0  0   7   33  1    MAIAPSAGALR + Oxidation (M)
873   520.794494   1039.574436   1039.577423   -2.87  1   7   13  1    VKAEGPGLNR
1082   584.355747   1166.696942   1165.675369   876  1   7   4.8  1    VPSRMVPRPK
1009   562.342589   1122.670626   1122.648239   19.9  1   7   5  1    GRRPARPGTR
1198   422.581888   1264.723836   1263.726059   790  1   7   11  1    MSFLLPKLTSK
1489   864.489958   1726.965364   1725.963821   580  1   7   11  1    SPRLVAPVPPGAAPANGR
1599   571.061190   4560.431312   4560.412369   4.15  1   7   3.9  1    SLYLETLHALEDLLTSLLQRNMTPQGLQIMIEHLSPWIK + Oxidation (M)
623   448.755270   895.495988   894.484451   1131  1   7   12  1    IKMTGTTK + Oxidation (M)
1352   481.282998   1440.827166   1439.850708   678  2   7   11  1    VKVAVRVRPMNR + Oxidation (M)
672   464.253719   926.492886   925.475647   1099  0   7   14  1    VEEPEPVK
1045   575.842111   1149.669670   1149.669205   0.40  2   7   9.3  1    KQMLKFIAR + Oxidation (M)
813   506.264027   1010.513502   1009.512711   991  2   7   17  1    KRQFEMR + Oxidation (M)
242   574.300872   573.293596   573.287064   11.4  0   7   15  1    STNPR
1113   599.248735   1196.482918   1196.496292   -11.18  1   7   1.9  1    FMRFMMMR + 3 Oxidation (M)
1173   625.353814   1248.693076   1247.665588   824  1   7   17  1    LGVSLTMARER + Oxidation (M)
1412   525.309096   1572.905460   1572.876968   18.1  2   7   9  1    SGLLNMTKIAQGGRK
612   447.263432   892.512312   891.517792   1116  0   7   13  1    SSLLLGFR
1125   606.368850   1210.723148   1210.739716   -13.68  2   7   7.3  1    KKSLSAISIHK
1467   566.631633   1696.873071   1696.874405   -0.79  1   7   21  1    HTKELSPTSDTNLVR
340   714.339040   713.331764   713.341812   -14.09  0   7   5.2  1    VSMSFK + Oxidation (M)
1227   650.395384   1298.776216   1298.753082   17.8  2   7   6.9  1    ASIIARVGNSRR
808   502.813566   1003.612580   1002.597427   1013  2   7   7.1  1    LGFPKKASR
890   523.303230   1044.591908   1043.576385   973  0   7   23  1    QWGQSLVVK
1513   609.998240   1826.972892   1826.985001   -6.63  1   7   18  1    LVELLLNSGSREQDVR
782   494.300529   986.586506   986.591293   -4.85  2   7   17  1    LKKFITTH
1108   597.856310   1193.698068   1193.676804   17.8  2   7   7.7  1    SKEVRYVVSK
806   501.290202   1000.565852   999.564743   1002  1   7   26  1    MSLRLQPR
201   516.300070   515.292794   514.286331   1957  0   7   15  1    AAPTR
440   406.248321   810.482090   809.487137   1229  2   7   6.1  1    KHIEKR
812   506.209217   1010.403882   1010.406219   -2.31  0   7   2.1  1    MHAGCTYR + Oxidation (M)
1011   563.795380   1125.576208   1124.574707   891  1   7   20  1    MISTTSKETK
1278   677.395419   1352.776286   1351.757187   754  1   7   10  1    TGSEGLALPRVPR
568   435.773705   869.532858   868.524261   1161  2   7   9.2  1    SHKTKIR
834   513.253797   1024.493042   1023.469513   1000  0   7   17  1    CLSPEYAGK
579   872.442341   871.435065   870.448700   1133  0   7   11  1    YYDALVK
1088   589.342763   1176.670974   1175.677460   845  1   7   14  1    AFSRNSLLIR
351   360.206806   718.399060   718.390808   11.5  1   7   32  1    RMVAAR + Oxidation (M)
717   477.231882   952.449212   951.448425   1052  0   7   12  1    VWGTTCTK
1476   570.984031   1709.930265   1709.931152   -0.52  0   7   17  1    SENAAPGLISELLLQR
1219   643.341226   1284.667900   1284.654297   10.6  2   7   19  1    MMRAAAKDVHR
215   535.281221   534.273945   533.280914   1862  1   7   26  1    GKDSK
1326   707.922002   1413.829452   1413.845612   -11.43  1   7   10  1    SFSLGVPRLIGIR
1367   723.936828   1445.859104   1444.832306   711  1   7   5.1  1    MQENLVKTLLLK + Oxidation (M)
275   622.346119   621.338843   620.324173   1636  1   7   15  1    KSGSSR
431   404.232791   806.451030   805.455841   1236  2   7   20  1    FAKERR
554   434.779808   867.545064   866.558960   1138  0   7   3.6  1    VVGLVVGPK
1237   437.257150   1308.749622   1307.760162   757  2   7   11  1    KTWGTVFKTLK
965   545.316699   1088.618846   1088.630188   -10.42  1   7   22  1    ISTISSVRAR
531   861.445950   860.438674   860.453827   -17.61  1   7   29  1    GVTMKGPR + Oxidation (M)
729   480.800543   959.586534   959.602844   -17.00  1   7   7.3  1    IPPKRPPR
1114   599.248735   1196.482918   1196.496292   -11.18  1   7   2.2  1    FMRFMMMR + 3 Oxidation (M)
1290   685.908636   1369.802720   1368.808838   726  2   7   11  1    KELAALLEAQKR
1298   692.325888   1382.637224   1382.661224   -17.36  1   7   12  1    QMNFKSNTLER + Oxidation (M)
785   496.303468   990.592384   989.577026   1026  1   7   7.6  1    SLFRQALR
1117   603.340419   1204.666286   1204.663788   2.07  2   7   22  1    AKKMFLKPQD
1479   857.958764   1713.902976   1713.883194   11.5  0   7   25  1    NIGAGVMQIDIIQGNR + Oxidation (M)
1291   685.908636   1369.802720   1368.794952   736  2   7   11  1    VLEATARAGGRIR
1238   437.257151   1308.749625   1307.727142   782  0   7   12  1    MPPPTILSTVPR
1335   714.339040   1426.663528   1426.673553   -7.03  1   7   14  1    APTGCHGESRVTR
1226   650.395384   1298.776216   1297.750641   790  1   7   7.9  1    WVGVEAARVIAK
1065   581.327258   1160.639964   1159.638290   864  0   7   24  1    MNLAIALTAAR + Oxidation (M)
1028   567.329679   1132.644806   1132.656403   -10.24  2   7   19  1    TIGSSASVKRK
299   323.673014   645.331476   645.333328   -2.87  0   7   24  1    ALEGEK
1030   567.330329   1132.646106   1131.643372   886  2   7   20  1    KDMLAALKSR
522   426.747582   851.480612   851.468719   14.0  1   7   11  1    LFRMASK
1517   614.017082   1839.029418   1839.018906   5.72  1   7   14  1    SVWCRSPLSPGLIVLR
1160   619.868702   1237.722852   1236.734268   799  1   7   8.6  1    LLVWQKSVHK
598   441.787331   881.560110   881.555893   4.78  1   7   3.4  1    VLRPRNK
1231   651.371656   1300.728760   1299.744476   757  2   7   23  1    LLKENQMLRR
1393   495.958271   1484.852985   1484.824554   19.1  2   7   14  1    TGVNPAVIMGARRK + Oxidation (M)
680   467.300949   932.587346   931.570190   1092  2   7   4.1  1    IEKSKSLK
1150   614.793685   1227.572818   1226.586487   804  1   7   12  1    GTGRGGGGGGGGGAPR
1213   641.882069   1281.749586   1280.742493   786  2   7   8.6  1    RARSAPAAAIAAR
940   538.326808   1074.639064   1073.619293   950  2   7   12  1    LKKTVTNDR
356   362.222380   722.430208   722.443893   -18.94  1   6   6.4  1    KHLVLN
1400   510.633589   1528.878939   1527.891907   646  1   6   12  1    LSGRLVLGLVSMAGR
588   439.759161   877.503770   876.485107   1162  1   6   15  1    MSRVLQK + Oxidation (M)
1317   699.408663   1396.802774   1395.772202   738  0   6   13  1    SPVDIVTGGISPVR
1518   309.009414   1848.012828   1846.990112   554  0   6   16  1    HSLATAAPVPTTLAQVDR
1140   407.906442   1220.697498   1220.706329   -7.23  2   6   14  1    LFKAMKGLGTR
394   382.219756   762.424960   762.409821   19.9  0   6   27  1    WVLAMK + Oxidation (M)
793   498.781027   995.547502   995.539978   7.56  0   6   17  1    HVIEELTR
977   550.793384   1099.572216   1099.580811   -7.82  0   6   25  1    NGMPGVGLLAR + Oxidation (M)
1072   583.358628   1164.702704   1163.688705   871  0   6   5.8  1    TLRPTPARPR
686   470.271795   938.529038   937.534500   1061  0   6   12  1    SLGHGLINK
567   435.755700   869.496848   869.508301   -13.17  0   6   13  1    VVGAAAVGAR
1316   699.408663   1396.802774   1395.794617   722  1   6   13  1    APAAAVVRAAVSASR
269   304.696201   607.377850   606.374069   1655  0   6   6.5  1    YIAIK
1477   571.277846   1710.811710   1710.784271   16.0  0   6   20  1    SMVSTSGAATASSAAGPSR + Oxidation (M)
673   465.279691   928.544830   927.550156   1072  0   6   27  1    TAQLVLQR
999   559.314071   1116.613590   1116.632492   -16.93  0   6   32  1    LTNLVIAMAR + Oxidation (M)
1002   560.339939   1118.665326   1117.649506   909  2   6   11  1    TYKEPKKPK
1027   567.329679   1132.644806   1131.628784   898  1   6   21  1    IIEKVDYPR
1334   713.335293   1424.656034   1424.675842   -13.90  0   6   17  1    FFTDSVNIMHAK + Oxidation (M)
1398   501.289997   1500.848163   1500.852463   -2.87  2   6   17  1    NQQNNKRVIFLK
627   450.274343   898.534134   898.517075   19.0  2   6   16  1    HKRTMVK
1194   633.368923   1264.723294   1264.725174   -1.49  0   6   14  1    VALPGVDVSRPR
160   474.279973   473.272697   472.275772   2111  0   6   35  1    AAGVR
1473   851.450000   1700.885448   1700.852905   19.1  2   6   31  1    VGQHWLSSTSKCRR
1299   692.406822   1382.799092   1381.771759   743  1   6   13  1    FTAILYRTLER
257   589.374545   588.367269   587.364258   1708  0   6   41  1    VVTAAK
437   404.734138   807.453724   806.443222   1253  2   6   17  1    MSSKRAK
809   503.305596   1004.596640   1004.576706   19.8  1   6   12  1    FNVAVTRAK
458   412.754207   823.493862   823.491577   2.77  0   6   9.1  1    VLLSHGAK
725   479.778735   957.542918   956.551559   1036  2   6   35  1    TLGGRGGRIA
1210   641.882041   1281.749530   1280.735336   792  1   6   9.6  1    GSGKVPWLKPGR
290   318.196595   634.378638   633.363190   1603  1   6   17  1    MISKR
743   484.787659   967.560766   967.563690   -3.02  1   6   12  1    VGMIPAPKR
574   435.775039   869.535526   869.519516   18.4  1   6   10  1    QRLQLGR
728   480.800543   959.586534   959.576340   10.6  2   6   8.8  1    LKESSLKR
1366   482.959367   1445.856273   1444.840210   703  0   6   7.4  1    GPPGTGLTVPPALLR
1026   567.329678   1132.644804   1131.640015   888  1   6   22  1    IERGELFLR
1381   734.326982   1466.639412   1466.653381   -9.52  1   6   7.3  1    VWDLKDDGNMMK + Oxidation (M)
576   435.775039   869.535526   868.549423   1135  0   6   11  1    LGKPSLVR
702   472.287458   942.560364   942.547119   14.1  2   6   25  1    QLRSAGRR
1131   608.846607   1215.678662   1214.687042   816  0   6   32  1    NLSVVILGASDK
382   374.185953   746.357354   745.360641   1337  0   6   21  1    TGSSGPLQ
519   426.246102   850.477652   850.477310   0.40  2   6   18  1    HKSKHSK
1119   603.340419   1204.666286   1204.648529   14.7  1   6   27  1    MASVLNVKESK
372   736.433292   735.426016   735.439133   -17.84  1   6   16  1    RAPPAPK
731   481.261317   960.508082   959.514801   1035  1   6   42  1    AAERSSALR
1242   655.382273   1308.749994   1307.727142   782  0   6   15  1    MPPPTILSTVPR
1158   619.868681   1237.722810   1236.705063   823  2   6   11  1    IHARKLSEQR
355   362.190712   722.366872   722.371124   -5.89  0   6   26  1    ANTYVR
899   526.360523   1050.706494   1049.696075   963  1   6   0.72  1    VLSILLKHK
357   362.222382   722.430212   722.443893   -18.94  1   6   7.9  1    KHLVLN
1355   721.422128   1440.829704   1440.830017   -0.22  0   6   17  1    GGTAILLLTGLEQR
1294   690.303389   1378.592226   1377.583038   733  1   6   8.3  1    DDEMENKQDVR
1050   575.843021   1149.671490   1148.655350   885  1   6   13  1    RLFGTVLESK
1507   901.884404   1801.754256   1801.786713   -18.01  1   6   4.3  1    GAGESGEEDPFPSRDPR
1118   603.340419   1204.666286   1203.642075   851  0   6   29  1    IIEVVDAIMTT
316   338.192795   674.371038   673.364639   1495  0   6   59  1    EEGVLK
730   480.800543   959.586534   958.581131   1049  1   6   10  1    KSGVTIQVK
1589   570.987173   3419.879382   3419.842575   10.8  2   5   5.5  1    NYWLVTVLHDRQINLNELAKQLGVGSGNLR
543   433.758620   865.502688   865.513367   -12.34  1   5   12  1    RDLLPPR
1498   872.442341   1742.870130   1741.894028   560  1   5   33  1    ASFFLSHDQRFFLK
898   524.826607   1047.638662   1046.627014   967  2   5   7.1  1    MIVSGKKLR + Oxidation (M)
1384   734.819159   1467.623766   1467.638748   -10.21  0   5   6.1  1    MSGGWMAQVGAWR + 2 Oxidation (M)
967   545.316699   1088.618846   1088.626373   -6.91  1   5   31  1    KTMVLGTPVK + Oxidation (M)
1464   566.311031   1695.911265   1694.899841   597  1   5   24  1    HTRPQVSSVRLMER
435   404.233029   806.451506   805.444641   1250  0   5   28  1    LAGVFGSR
249   583.295794   582.288518   582.287415   1.89  0   5   9.5  1    AGGGGHK
332   352.172635   702.330718   701.316650   1446  0   5   13  1    MHTGEK
654   459.279629   916.544706   915.538925   1099  0   5   22  1    LDVISTLR
1178   626.298630   1250.582708   1250.578781   3.14  0   5   22  1    NHVMVMDFVK + 2 Oxidation (M)
1508   901.884404   1801.754256   1801.772995   -10.40  0   5   4.5  1    LWEQFSDMGFQQDR + Oxidation (M)
796   498.803153   995.591754   995.598831   -7.11  2   5   10  1    HVRSTLRK
544   433.758623   865.502694   864.504196   1155  2   5   13  1    RRSPPPR
1258   663.895395   1325.776238   1325.777908   -1.26  2   5   13  1    LVSAQQKAPTRK
1561   935.718615   2804.134017   2804.147598   -4.84  1   5   1.5  1    STMGNEASYPAEMCSHFDNDEIKR + Oxidation (M)
628   450.274402   898.534252   897.517105   1133  1   5   20  1    KLEDIALP
893   523.303467   1044.592382   1043.577026   973  2   5   37  1    ARRMAANVR
1159   619.868686   1237.722820   1236.734268   799  1   5   12  1    LLVWQKSVHK
1104   597.855257   1193.695962   1192.700180   835  2   5   13  1    GYLVKMGGKIK
1431   539.984765   1616.932467   1616.924988   4.63  0   5   12  1    LALLLSQFVGSQSVR
754   489.313867   976.613182   975.611694   1027  1   5   4.6  1    LGAFITKVK
1343   716.435304   1430.856056   1430.860916   -3.40  1   5   6.3  1    RTVTSILYPLLR
402   384.235567   766.456582   765.449707   1315  1   5   14  1    TPAPPRK
1302   694.422226   1386.829900   1385.842804   712  1   5   7.4  1    MRSLSTLKPLLK
1289   685.908636   1369.802720   1368.812927   723  0   5   17  1    LGLSVFTVIPRPA
1531   993.402622   1984.790692   1983.790009   504  0   5   1.7  1    EFIDTMMSNTECFSEK + Oxidation (M)
1565   571.544148   2852.684360   2851.665619   357  2   5   1.1  1    VKGSRLVKPSLCLALLCPAFLVGVVR
517   426.246090   850.477628   849.459595   1198  0   5   21  1    VYEQLAK
1534   503.305592   2009.193264   2009.163300   14.9  1   5   2.9  1    TNLKDVIGAGLQQLLASLR
254   588.330554   587.323278   587.327850   -7.78  0   5   43  1    GAEALK
557   435.251143   868.487734   868.487885   -0.17  1   5   18  1    PVRSSAPR
1275   451.932426   1352.775450   1351.757217   753  1   5   17  1    VDPRIGGGGVQLGK
434   404.232931   806.451310   805.455856   1236  1   5   31  1    GRFAISR
1196   422.581888   1264.723836   1264.711227   9.97  2   5   19  1    RQAPAGSPRGLR
1197   422.581888   1264.723836   1263.715988   798  2   5   20  1    NKGGVAVKAHQR
352   720.365663   719.358387   718.368347   1378  1   5   41  1    SKGMIPS
1576   1492.710408   2983.406264   2982.407608   335  2   5   23  1    LMGCDSFDQFSAERRNSILTETLHR
1092   589.342937   1176.671322   1175.677444   845  2   5   25  1    YQRLLEKAR
1382   734.819159   1467.623766   1467.651764   -19.08  0   5   7  1    WDSIPNTEESYK
624   898.414366   897.407090   897.401459   6.27  0   5   14  1    GSLDGFMR + Oxidation (M)
780   494.300528   986.586504   985.592010   1009  1   5   31  1    NLGNIKVTK
1288   457.607700   1369.801272   1369.775146   19.1  1   5   18  1    IQLQKVLGPSCK
687   470.271798   938.529044   938.543655   -15.57  0   5   18  1    EALATPLPK
919   533.339863   1064.665174   1064.645447   18.5  1   5   4.5  1    TAALVLHGRK
1546   371.227400   2221.320744   2221.302032   8.42  0   5   2.2  1    SNLPLALGLALVAFCLLALPR
311   669.380138   668.372862   668.360580   18.4  0   5   15  1    TVHQGK
383   374.185956   746.357360   746.344650   17.0  0   5   27  1    LGNEVTD
621   448.258792   894.503032   894.492310   12.0  0   5   22  1    SQIPPTPR
739   484.250995   966.487438   966.480423   7.26  0   5   31  1    MSTSLSLGR + Oxidation (M)
1560   935.718615   2804.134017   2804.167404   -11.91  2   5   1.7  1    MSHGHSHGGGGCRCAAEREEPPEQR + Oxidation (M)
400   384.235567   766.456582   765.449722   1315  0   5   16  1    LPPGAGVR
1566   571.737456   2853.650900   2853.626205   8.65  2   5   2.7  1    AMKLLLLYGAELGVRNAASVTPVQLAR
235   562.342594   561.335318   560.328186   1797  2   5   20  1    QKKAS
894   523.303531   1044.592510   1043.597488   953  0   5   42  1    SSIQLQAVAK
1257   663.895392   1325.776232   1325.791824   -11.76  1   4   16  1    LTLEPKITVNAK
1111   599.240368   1196.466184   1195.486252   820  1   4   2  1    SYRCHECGK
723   479.277108   956.539664   956.551529   -12.40  2   4   37  1    LKRSNSPR
614   448.213987   894.413422   893.396652   1138  0   4   22  1    CFQHFR
259   597.375768   596.368492   595.355423   1702  1   4   14  1    KGVHR
224   538.272079   537.264803   536.259460   1875  0   4   28  1    DFGAK
1572   989.736597   2966.187963   2965.202835   332  2   4   2.5  1    SMMSPMAERSMMSAYERSMMSAYER + Oxidation (M)
271   612.322328   611.315052   610.318695   1633  0   4   12  1    GHLER
525   428.261355   854.508158   853.488220   1195  1   4   16  1    GRAVAPGAR
1279   677.395420   1352.776288   1352.767700   6.35  0   4   20  1    VGAVPPAKPQHPR
721   479.276889   956.539226   956.554230   -15.69  0   4   39  1    IAVTLPESK
191   503.305592   502.298316   501.302307   1987  1   4   47  1    GKAAR
199   514.297959   513.290683   512.295837   1942  0   4   9.9  1    IANPV
322   340.208932   678.403312   677.411179   1465  1   4   15  1    KLAAYI
892   523.303306   1044.592060   1044.607986   -15.25  2   4   48  1    AFNKNVPKK
735   482.302215   962.589878   961.570877   1060  1   4   11  1    RLLNTFAK
443   406.248667   810.482782   809.487167   1230  1   4   13  1    VPRSVPR
1106   597.855285   1193.696018   1193.681503   12.2  1   4   17  1    MLLRAHKPGR + Oxidation (M)
1396   1492.710408   1491.703132   1491.688858   9.57  0   4   29  1    MAEGGGQNHHEVVK
1574   989.736597   2966.187963   2965.202835   332  2   4   2.7  1    SMMSAYERSMMSPMAERSMMSAYER + Oxidation (M)
287   634.295218   633.287942   633.297821   -15.60  0   4   25  1    MPGAMK
1171   625.353814   1248.693076   1247.683334   809  2   4   37  1    RQLAETKSSTK
552   434.779768   867.544984   867.536407   9.89  1   4   7.2  1    MVKLLHK
1192   633.368923   1264.723294   1264.699997   18.4  2   4   25  1    DRGPRLLGEPR
303   651.322812   650.315536   649.321747   1531  0   4   40  1    VTSGMR
914   531.816180   1061.617808   1061.601532   15.3  1   4   28  1    RILMGSTLR + Oxidation (M)
1001   560.339939   1118.665326   1117.649536   909  1   4   18  1    QLQEVKFVK
1172   625.353814   1248.693076   1248.689987   2.47  2   4   38  1    AAFKEPKMALK + Oxidation (M)
970   547.331935   1092.649318   1092.640366   8.19  1   4   14  1    THTAVKIAPR
520   426.246109   850.477666   850.465607   14.2  0   4   29  1    LMMSLLK + Oxidation (M)
1090   589.342768   1176.670984   1175.677002   845  0   4   31  1    SMTILVLMLR
1097   590.866597   1179.718642   1179.701553   14.5  1   4   9.4  1    QYFLGILKAK
337   713.335293   712.328017   711.330017   1403  0   3   19  1    DPGPGGGR
1195   633.368923   1264.723294   1263.715988   797  1   3   27  1    AVRQGHLSLQR
1505   901.392285   1800.770018   1799.749298   567  0   3   10  1    VEPDNSSQATGEGCGHR
1066   581.327258   1160.639964   1160.633560   5.52  1   3   52  1    AVRSVLANGMK + Oxidation (M)
444   406.750016   811.485480   810.482391   1238  1   3   16  1    SKPARRP
1537   1045.100000   2088.185448   2087.162628   490  1   3   13  1    YTLTLLAQDQGLQPLSAKK
1562   935.718615   2804.134017   2803.179123   341  2   3   2.2  1    SLFPQGMGRGQKDMMCPPSCCVGR + 3 Oxidation (M)
1356   721.422128   1440.829704   1440.842560   -8.92  2   3   28  1    KQPPRAHNLKPR
1493   868.969208   1735.923864   1734.945084   564  1   3   46  1    ALKMHGGGPSVTAGVPLK + Oxidation (M)
802   501.289997   1000.565442   999.571274   995  1   3   59  1    IEKRPLSTG
1555   922.043001   2763.107175   2763.129181   -7.96  1   3   1.5  1    DPCDPNPCQNDGICVNVKGMASCR
644   457.264013   912.513474   912.496338   18.8  1   3   31  1    LPARMGPR + Oxidation (M)
942   538.326808   1074.639064   1074.629807   8.61  1   3   25  1    FGGISVRLAR
253   587.327156   586.319880   586.329926   -17.13  1   3   31  1    AGGARR
1025   567.329678   1132.644804   1131.643372   885  2   3   43  1    KDMLAALKSR
1243   655.382273   1308.749994   1307.730972   779  1   3   27  1    VEGQGSPIPLRR
1423   800.314902   1598.615252   1598.594559   12.9  0   3   1.1  1    CNITPCENMECR + Oxidation (M)
1424   800.816168   1599.617784   1598.594559   640  0   3   1.7  1    CNITPCENMECR + Oxidation (M)
1225   650.395384   1298.776216   1298.755768   15.7  1   3   19  1    LSSLIIGPSKER
1073   583.376536   1164.738520   1164.734268   3.65  1   3   3.6  1    LVSHVIRTLK
1274   451.932425   1352.775447   1352.748581   19.9  2   3   27  1    LVMKAYRDTIK + Oxidation (M)
556   435.251139   868.487726   868.487885   -0.18  1   3   30  1    PVRSSAPR
768   492.284871   982.555190   982.560669   -5.58  2   3   29  1    RMHVLRR + Oxidation (M)
1264   669.380138   1336.745724   1335.737091   755  2   3   36  1    ERIGAKHQELR
1494   869.469475   1736.924398   1735.915176   581  1   3   48  1    VASGPMPVHTTSKRPR + Oxidation (M)
408   390.732866   779.451180   779.465378   -18.22  0   3   32  1    GVIHGLGK
553   434.779808   867.545064   866.533783   1167  1   3   9.2  1    ISVKHVGK
1564   571.544148   2852.684360   2851.643082   365  0   3   1.9  1    MAAVALMPPPLLLLLLLASPPAASAPSAR
442   406.248667   810.482782   810.493637   -13.39  1   3   17  1    GRRPGIR
1492   868.969208   1735.923864   1735.915176   5.00  1   3   53  1    VASGPMPVHTTSKRPR + Oxidation (M)
1598   571.047349   3990.280511   3990.284256   -0.94  2   3   2.2  1    IPIGTEIEGMNILGLVLFALVLGVALKKLGSEGEDLIR
144   460.244818   459.237542   459.232925   10.1  0   3   68  1    VDGGI
489   421.758239   841.501926   840.481735   1214  2   3   36  1    SHAGKKTL
523   427.253678   852.492804   851.497711   1169  1   3   25  1    LEHGIKR
1046   575.842111   1149.669670   1149.675735   -5.28  0   3   28  1    LVHEIGLELK
1495   869.469475   1736.924398   1735.900513   590  2   2   52  1    ENLESRLKNAPYFR
1003   560.339939   1118.665326   1118.681183   -14.17  1   2   25  1    GFIKVTLSVR
1094   589.342961   1176.671370   1175.677475   845  1   2   41  1    LQELPGKVHR
1276   677.395413   1352.776274   1351.797577   724  1   2   31  1    RTLSFLAYIIR
1006   374.578251   1120.712925   1119.712784   893  1   2   3.2  1    KLVLEIIHR
145   462.268337   461.261061   460.264542   2165  0   2   1.3e+02  1    GIGSK
1054   384.582231   1150.724865   1150.718613   5.43  1   2   5.3  1    LRVDIAVPLR
216   535.285030   534.277754   534.280182   -4.54  0   2   54  1    AYGPK
405   385.273281   768.532010   768.533371   -1.77  1   2   6.4  1    VLRLIR
1143   611.356109   1220.697666   1220.679840   14.6  1   2   39  1    SGKMGSLALLTK + Oxidation (M)
1069   582.855422   1163.696292   1163.677475   16.2  0   2   18  1    VLRPPDLAQR
1325   707.922002   1413.829452   1412.846329   696  2   2   31  1    VKKGVNILSAQTR
1078   389.253631   1164.739065   1163.739014   859  2   2   4.4  1    GKKVAPAPAVVK
1378   729.935284   1457.856016   1457.852692   2.28  1   2   31  1    KELIINEILVMK + Oxidation (M)
1395   743.434890   1484.855228   1483.835846   687  2   2   37  1    SSTQVRKSPVPLSV
1578   1043.754550   3128.241822   3128.272095   -9.68  1   2   2.2  1    HWHMDHFCCFECEASLGGQRYVMR + Oxidation (M)
1091   589.342770   1176.670988   1175.652313   866  1   2   47  1    SLSLGRAAHHK
1584   1078.425578   3232.254906   3231.285797   300  2   2   0.9  1    ENIWKMQGLMFRCSTSCCEDSQASMQ + 3 Oxidation (M)
388   377.745935   753.477318   753.486084   -11.63  2   2   11  1    IKHTKK
1532   993.402622   1984.790692   1984.798096   -3.73  0   2   3.6  1    EIQSGSSSSDAEESSEDNK
192   503.305596   502.298320   501.291077   2009  0   2   82  1    AINGK
1312   466.607758   1396.801446   1395.784744   728  2   2   38  1    VTRLSVSRWHR
1034   569.340000   1136.665448   1135.646164   898  2   2   27  1    IKQPNGSKHK
753   977.449959   976.442683   975.429764   1038  0   2   35  1    NWEGDDIK
1552   613.115213   2448.431748   2448.396469   14.4  2   2   6  1    SLPGVNRATLAAIIEHLYRVQK
1585   1078.425578   3232.254906   3232.263321   -2.60  1   2   0.95  1    QDGDEEFEEEEEESENKSMDTDPETIR + Oxidation (M)
545   433.758623   865.502694   864.492966   1168  0   2   29  1    QSHKPLR
1540   737.631907   2209.873893   2208.891647   445  2   2   3.2  1    EEEKEEEEEEEEEKEEK
1526   987.385968   1972.757384   1972.789124   -16.09  1   2   2.4  1    GSGKSNMGTSGDHDDSFMK + Oxidation (M)
1031   567.828524   1133.642496   1133.644424   -1.70  2   1   62  1    SIKAFKESPK
1530   992.904624   1983.794696   1983.822357   -13.94  0   1   3.8  1    ATQADLMELDMAMEPDR + 3 Oxidation (M)
1533   993.402622   1984.790692   1983.822357   488  0   1   4  1    ATQADLMELDMAMEPDR + 3 Oxidation (M)
936   537.300812   1072.587072   1071.585861   934  1   1   1.4e+02  1    MSIPEALRR
1314   466.607759   1396.801449   1396.789841   8.31  2   1   42  1    ANINANLQGKARK
403   384.771960   767.529368   767.526886   3.23  0   1   3.1  1    VLLKPAK
1068   582.353156   1162.691760   1161.673050   877  2   1   26  1    EIPRARGHVK
1539   731.619881   2191.837815   2190.861633   446  0   1   1.3  1    MCAPADGPPTGEADGGCLEDR + Oxidation (M)
1130   607.227176   1212.439800   1211.455063   813  1   1   2.1  1    MMMMSMMKK + 4 Oxidation (M)
230   544.303814   543.296538   543.301651   -9.41  0   1   17  1    NVSPK
901   526.360678   1050.706804   1049.696075   963  1   1   2.1  1    VLSILLKHK
1383   734.819159   1467.623766   1466.604874   695  0   1   16  1    EEEQLSYDDPDK
1033   568.853319   1135.692086   1134.680115   892  0   1   14  1    QIQVIFLFK
1579   1043.754550   3128.241822   3127.284317   306  0   1   2.7  1    AWALFPPSDDYDDTDDDDPFNPQQESK
1241   655.382272   1308.749992   1308.758759   -6.70  0   1   43  1    VLLGHLLMELR + Oxidation (M)
1315   699.408663   1396.802774   1395.794617   722  1   1   45  1    APAAAVVRAAVSASR
1287   457.607700   1369.801272   1368.783707   743  2   1   43  1    ERIKQQIALDR
321   340.208931   678.403310   677.397293   1485  1   1   31  1    TFRVR
455   412.754131   823.493710   823.491577   2.59  0   1   30  1    APILPGTR
320   340.208931   678.403310   678.406448   -4.63  1   1   31  1    SKFGIK
1586   1078.425578   3232.254906   3232.263321   -2.60  1   1   1.2  1    QDGDEEFEEEEEESENKSMDTDPETIR + Oxidation (M)
1380   734.326982   1466.639412   1466.664612   -17.18  0   1   24  1    LQEIHPECGPCK
752   976.395425   975.388149   975.371597   17.0  0   1   5.4  1    DDAMSEHR + Oxidation (M)
1594   1248.481597   3742.422963   3742.483749   -16.24  1   1   1  1    TKNSYWQCSECDQAGSSDMEADMAMETLPDGTK
1265   669.380138   1336.745724   1335.762268   736  1   1   60  1    VGLPPAGTAELRR
1101   398.251814   1191.733614   1190.713531   857  0   1   11  1    QPAPGLLGAVLR
1420   799.816772   1597.618992   1597.623566   -2.86  0   1   2.9  1    MAEEMVEAAGEDER + 2 Oxidation (M)
1422   800.314902   1598.615252   1597.623566   621  0   1   1.9  1    MAEEMVEAAGEDER + 2 Oxidation (M)
1596   1248.816292   3743.427048   3742.483749   252  1   1   1  1    TKNSYWQCSECDQAGSSDMEADMAMETLPDGTK
1568   976.061084   2925.161424   2924.197769   330  0   1   2.9  1    GYYNQSEDGSHTIQIMYGCDVGSDGR + Oxidation (M)
630   450.274402   898.534252   897.535736   1113  1   1   58  1    KLSLPMPI
360   362.253697   722.492842   722.480270   17.4  1   1   2.1  1    LPKLPR
937   537.300812   1072.587072   1072.587646   -0.54  0   1   1.6e+02  1    NLTNLASNVK
305   653.335757   652.328481   651.312225   1560  1   0   53  1    SSRMR + Oxidation (M)
1259   663.895403   1325.776254   1324.771423   758  0   0   42  1    LISILTAPSPASR
1411   525.309096   1572.905460   1572.884384   13.4  1   0   45  1    MVLLPRKPVTMTR + 2 Oxidation (M)
1051   576.369149   1150.723746   1150.707382   14.2  0   0   11  1    SPLSPGLIVLR
897   524.826607   1047.638662   1046.623657   970  1   0   23  1    QKFVALVSR
1138   611.355882   1220.697212   1219.692444   824  2   0   60  1    DLLYIGKDRK
251   583.358628   582.351352   582.348938   4.15  1   0   12  1    LKVHS
250   583.337728   582.330452   582.323776   11.5  0   0   32  1    HAISR
512   425.775893   849.537234   848.523209   1195  0   0   13  1    LHITIPR
900   526.360523   1050.706494   1050.702560   3.74  1   0   2.5  1    VLLRRPVAK
238   569.340000   568.332724   568.333298   -1.01  0   0   29  1    VTPPR
1595   1248.481597   3742.422963   3742.364960   15.5  1   0   1.2  1    KECSSTSNAECDCTPGFHCLGAGCSMCEQDCK
1529   992.904624   1983.794696   1983.790009   2.36  0   0   5.2  1    EFIDTMMSNTECFSEK + Oxidation (M)
1593   1146.451789   3436.333539   3435.276901   308  0   0   1.3  1    VNPECDDQEDCSDGSDEAHCECGLQPAWR
1558   927.375155   2779.103637   2779.124069   -7.35  1   0   3.9  1    CSSMCTASYLCRVNSSPHSEQMR + 2 Oxidation (M)
1   300.198786   299.191510              
2   300.700464   299.693188              
3   304.696201   303.688925              
4   307.175265   306.167989              
5   314.166522   313.159246              
6   316.180717   315.173441              
7   316.180753   315.173477              
8   316.192652   315.185376              
9   316.682444   315.675168              
10   317.183235   316.175959              
11   318.196595   317.189319              
12   319.228232   318.220956              
13   321.725222   320.717946              
14   322.976499   321.969223              
15   322.976505   321.969229              
16   323.171351   322.164075              
17   323.673014   322.665738              
18   334.221436   333.214160              
19   336.705212   335.697936              
20   338.193051   337.185775              
21   344.034523   343.027247              
22   346.706551   345.699275              
23   347.208303   346.201027              
24   349.184760   348.177484              
25   349.185463   348.178187              
26   349.185545   348.178269              
27   349.185666   348.178390              
28   351.242803   350.235527              
29   355.069842   354.062566              
30   357.716138   356.708862              
31   360.171324   359.164048              
32   360.175169   359.167893              
33   362.757363   361.750087              
34   362.758765   361.751489              
35   363.219073   362.211797              
36   363.225779   362.218503              
37   363.765205   362.757929              
38   367.698008   366.690732              
39   368.719887   367.712611              
40   369.221119   368.213843              
41   371.101307   370.094031              
42   371.227400   370.220124              
43   371.350872   370.343596              
44   375.201330   374.194054              
45   375.709548   374.702272              
46   377.232893   376.225617              
47   377.745935   376.738659              
48   379.248821   378.241545              
49   379.250027   378.242751              
50   383.200716   382.193440              
51   384.235567   383.228291              
52   384.771960   383.764684              
53   385.273281   384.266005              
54   390.732911   389.725635              
55   391.212408   390.205132              
56   394.729197   393.721921              
57   396.198887   395.191611              
58   397.213764   396.206488              
59   397.723050   396.715774              
60   398.214594   397.207318              
61   399.240542   398.233266              
62   399.245787   398.238511              
63   401.262052   400.254776              
64   402.716012   401.708736              
65   404.233008   403.225732              
66   404.734138   403.726862              
67   406.220922   405.213646              
68   406.248321   405.241045              
69   406.750016   405.742740              
70   407.760618   406.753342              
71   410.227269   409.219993              
72   410.227269   409.219993              
73   410.729003   409.721727              
74   410.731595   409.724319              
75   411.222416   410.215140              
76   411.228961   410.221685              
77   412.746100   411.738824              
78   413.225603   412.218327              
79   413.247494   412.240218              
80   414.761364   413.754088              
81   415.037216   414.029940              
82   415.253645   414.246369              
83   415.253671   414.246395              
84   415.253711   414.246435              
85   415.340921   414.333645              
86   418.212010   417.204734              
87   418.229511   417.222235              
88   419.260718   418.253442              
89   420.237521   419.230245              
90   421.253599   420.246323              
91   421.758081   420.750805              
92   421.758205   420.750929              
93   421.758294   420.751018              
94   421.759131   420.751855              
95   422.259724   421.252448              
96   423.227185   422.219909              
97   425.204740   424.197464              
98   426.246093   425.238817              
99   426.747582   425.740306              
100   431.336164   430.328888              
101   432.252586   431.245310              
102   432.885189   431.877913              
103   433.250595   432.243319              
104   433.716097   432.708821              
105   434.759087   433.751811              
106   434.766217   433.758941              
107   435.251088   434.243812              
108   435.267702   434.260426              
109   435.752986   434.745710              
110   435.773736   434.766460              
111   435.775039   434.767763              
112   436.274885   435.267609              
113   438.718876   437.711600              
114   439.756740   438.749464              
115   440.253769   439.246493              
116   440.258510   439.251234              
117   440.731309   439.724033              
118   441.245355   440.238079              
119   442.763485   441.756209              
120   443.265019   442.257743              
121   443.265186   442.257910              
122   447.755605   446.748329              
123   448.213987   447.206711              
124   448.257737   447.250461              
125   448.258771   447.251495              
126   448.755270   447.747994              
127   449.771225   448.763949              
128   450.274343   449.267067              
129   451.758071   450.750795              
130   451.768784   450.761508              
131   452.259620   451.252344              
132   453.357261   452.349985              
133   455.248744   454.241468              
134   456.250454   455.243178              
135   458.138985   457.131709              
136   458.783995   457.776719              
137   459.279629   458.272353              
138   459.279666   458.272390              
139   459.279675   458.272399              
140   459.279687   458.272411              
141   459.279698   458.272422              
142   459.331378   458.324102              
143   459.657932   458.650656              
146   462.415012   461.407736              
147   462.770727   461.763451              
148   464.253719   463.246443              
149   465.777284   464.770008              
150   467.422751   466.415475              
151   468.713159   467.705883              
152   469.757823   468.750547              
153   470.783718   469.776442              
154   471.285631   470.278355              
155   471.782693   470.775417              
156   471.783725   470.776449              
157   472.287516   471.280240              
158   472.287516   471.280240              
159   474.118987   473.111711              
162   475.276480   474.269204              
163   475.778228   474.770952              
164   477.230082   476.222806              
165   479.276889   478.269613              
166   479.778735   478.771459              
167   479.781575   478.774299              
168   480.279078   479.271802              
169   481.261317   480.254041              
170   481.261683   480.254407              
171   481.277435   480.270159              
172   481.823952   480.816676              
173   482.151303   481.144027              
174   482.302215   481.294939              
175   482.767812   481.760536              
176   483.279262   482.271986              
177   483.367671   482.360395              
179   487.790005   486.782729              
180   490.285658   489.278382              
181   491.803839   490.796563              
182   493.317574   492.310298              
183   494.294630   493.287354              
184   496.303352   495.296076              
185   496.303352   495.296076              
186   499.274402   498.267126              
187   499.274443   498.267167              
188   503.106830   502.099554              
189   503.106972   502.099696              
190   503.305067   502.297791              
193   506.324016   505.316740              
194   507.800168   506.792892              
195   510.760157   509.752881              
196   511.261233   510.253957              
197   512.280236   511.272960              
198   512.772783   511.765507              
200   514.799633   513.792357              
203   517.468522   516.461246              
204   518.316705   517.309429              
205   518.466898   517.459622              
206   518.964860   517.957584              
207   518.964860   517.957584              
208   518.964860   517.957584              
209   519.138454   518.131178              
210   522.813027   521.805751              
211   523.471685   522.464409              
212   530.748400   529.741124              
213   530.812154   529.804878              
214   531.759760   530.752484              
218   535.786386   534.779110              
219   536.164980   535.157704              
220   536.164988   535.157712              
221   536.804302   535.797026              
222   537.151101   536.143825              
223   537.487384   536.480108              
225   539.781736   538.774460              
226   542.256754   541.249478              
227   542.585828   541.578552              
228   542.807526   541.800250              
229   543.300806   542.293530              
231   547.331935   546.324659              
236   563.797911   562.790635              
237   564.296782   563.289506              
239   569.354431   568.347155              
240   571.477917   570.470641              
241   572.806465   571.799189              
244   574.769896   573.762620              
245   576.369282   575.362006              
246   577.126281   576.119005              
247   582.353156   581.345880              
248   582.855422   581.848146              
252   587.327152   586.319876              
255   589.342769   588.335493              
256   589.342961   588.335685              
258   596.873944   595.866668              
260   597.856379   596.849103              
261   599.248735   598.241459              
267   605.801130   604.793854              
268   606.368856   605.361580              
270   608.385169   607.377893              
272   612.823919   611.816643              
277   624.442253   623.434977              
278   624.943779   623.936503              
279   625.822455   624.815179              
286   633.369389   632.362113              
288   634.370667   633.363391              
289   635.380000   634.372724              
293   636.798031   635.790755              
295   644.860000   643.852724              
296   322.976499   643.938446              
297   322.976505   643.938458              
300   646.456582   645.449306              
301   646.957660   645.950384              
304   652.768225   651.760949              
306   658.006993   656.999717              
307   658.510473   657.503197              
308   659.000548   657.993272              
309   659.513855   658.506579              
310   667.176871   666.169595              
314   673.813170   672.805894              
323   340.259177   678.503802              
324   340.259177   678.503802              
334   705.256967   704.249691              
335   705.762976   704.755700              
336   712.830826   711.823550              
344   714.879726   713.872450              
353   721.733417   720.726141              
354   722.236824   721.229548              
361   362.757363   723.500174              
362   362.758765   723.502978              
364   363.765205   725.515858              
365   729.857887   728.850611              
366   731.619881   730.612605              
367   731.846506   730.839230              
374   737.631907   736.624631              
399   384.235565   766.456578              
404   384.772010   767.529468              
474   418.015992   834.017432              
475   418.015992   834.017432              
484   421.380773   840.746994              
485   841.932726   840.925450              
499   422.388737   842.762922              
507   424.929476   847.844400              
509   425.552737   849.090922              
510   425.552737   849.090922              
513   425.775893   849.537234              
533   432.654642   863.294732              
582   872.942042   871.934766              
714   952.835574   951.828298              
756   977.792975   976.785699              
786   496.442809   990.871066              
792   995.402470   994.395194              
810   336.566728   1006.678356              
811   336.566728   1006.678356              
844   344.034523   1029.081741              
855   517.468522   1032.922492              
856   517.966432   1033.918312              
857   517.966432   1033.918312              
858   517.966432   1033.918312              
859   517.966432   1033.918312              
863   518.467110   1034.919668              
864   518.467110   1034.919668              
865   518.467110   1034.919668              
866   518.467110   1034.919668              
867   519.466070   1036.917588              
880   1045.100000   1044.092724              
895   524.455628   1046.896704              
896   524.826607   1047.638662              
902   528.551058   1055.087564              
968   546.839929   1091.665306              
969   546.839929   1091.665306              
978   550.899911   1099.785270              
979   550.899911   1099.785270              
1021   567.133658   1132.252764              
1032   568.630978   1135.247404              
1035   569.354431   1136.694310              
1036   571.440889   1140.867226              
1037   571.440889   1140.867226              
1057   577.172707   1152.330862              
1074   583.376536   1164.738520              
1076   389.253629   1164.739059              
1096   590.720330   1179.426108              
1098   590.866597   1179.718642              
1099   595.616658   1189.218764              
1127   607.227126   1212.439700              
1128   607.227126   1212.439700              
1129   607.227126   1212.439700              
1137   611.355882   1220.697212              
1139   611.355882   1220.697212              
1169   624.442253   1246.869954              
1170   624.943779   1247.873006              
1202   635.380000   1268.745448              
1221   646.456582   1290.898612              
1222   646.957660   1291.900768              
1244   658.006993   1313.999434              
1245   658.510469   1315.006386              
1246   658.510470   1315.006388              
1247   658.510507   1315.006462              
1248   659.000722   1315.986892              
1249   659.000722   1315.986892              
1252   659.513855   1317.013158              
1266   672.033284   1342.052016              
1267   672.033288   1342.052024              
1268   672.033288   1342.052024              
1292   459.331378   1374.972306              
1293   459.657932   1375.951968              
1318   351.242803   1400.942108              
1321   705.256967   1408.499382              
1322   705.762976   1409.511400              
1332   709.093372   1416.172192              
1357   721.733417   1441.452282              
1358   481.823952   1442.450028              
1359   722.236824   1442.459096              
1360   482.151303   1443.432081              
1388   371.350872   1481.374384              
1397   1493.054417   1492.047141              
1410   1573.541279   1572.534003              
1413   1574.066056   1573.058780              
1418   796.323239   1590.631926              
1419   799.816772   1597.618992              
1421   800.314902   1598.615252              
1425   537.151101   1608.431475              
1426   537.487384   1609.440324              
1433   1626.999828   1625.992552              
1434   1627.497764   1626.490488              
1438   547.780484   1640.319624              
1475   853.502231   1704.989910              
1504   901.392285   1800.770018              
1519   467.422751   1865.661900              
1520   474.118987   1892.446844              
1521   952.835574   1903.656596              
1522   319.228232   1909.325736              
1523   483.367671   1929.441580              
1525   977.792975   1953.571398              
1527   987.385968   1972.757384              
1528   987.385968   1972.757384              
1535   1022.351215   2042.687878              
1536   415.340921   2071.668225              
1538   431.336164   2151.644440              
1550   453.357261   2261.749925              
1554   922.043001   2763.107175              
1556   922.043001   2763.107175              
1557   927.375155   2779.103637              
1559   927.375155   2779.103637              
1567   976.061084   2925.161424              
1570   976.061084   2925.161424              
1571   989.736597   2966.187963              
1573   989.736597   2966.187963              
1575   995.068028   2982.182256              
1577   1493.054417   2984.094282              
1580   1043.754550   3128.241822              
1581   1043.754550   3128.241822              
1582   1573.541279   3145.068006              
1583   1574.066056   3146.117560              
1587   1626.999828   3251.985104              
1588   1627.497764   3252.980976              
1591   1146.118617   3435.334023              
1592   1146.118617   3435.334023              

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 20 ppm (# 13C = 1)
Fragment Mass Tolerance: ± 1 Da
Max Missed Cleavages   : 2
Instrument type        : ESI-TRAP
Number of queries      : 1599

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
Elution from: 22.95 to 26.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8680517.7 FinneganScanNumber: 1322
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 2
Elution from: 22.97 to 26.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2526081.4 FinneganScanNumber: 1326
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 3
Elution from: 31.73 to 35.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 347590.8 FinneganScanNumber: 2112
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 4
Elution from: 35.65 to 39.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2618974.6 FinneganScanNumber: 2533
Score greater than 16 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 5
Elution from: 20.44 to 24.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 306150.3 FinneganScanNumber: 1087
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 6
Elution from: 29.93 to 33.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22248933.7 FinneganScanNumber: 1950
Score greater than 14 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 7
Elution from: 33.94 to 37.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7396471.8 FinneganScanNumber: 2306
Score greater than 14 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 8
Elution from: 22.81 to 26.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 482083.9 FinneganScanNumber: 1308
Score greater than 14 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 9
Elution from: 31.33 to 35.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5783697.2 FinneganScanNumber: 2074
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 10
Elution from: 31.43 to 35.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 876181.7 FinneganScanNumber: 2085
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 11
Elution from: 32.84 to 36.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11247808.7 FinneganScanNumber: 2206
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 12
Elution from: 41.23 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16879466.0 FinneganScanNumber: 3178
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 13
Elution from: 15.94 to 19.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 184806.7 FinneganScanNumber: 805
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 14
Elution from: 7.19 to 11.20 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4570359.9 FinneganScanNumber: 412
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 15
Elution from: 3.92 to 7.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3021194.1 FinneganScanNumber: 273
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 16
Elution from: 32.34 to 36.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1247875.6 FinneganScanNumber: 2161
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 17
Elution from: 32.36 to 36.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 276168.3 FinneganScanNumber: 2164
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 18
Elution from: 25.87 to 29.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8330851.4 FinneganScanNumber: 1598
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 19
Elution from: 24.28 to 28.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4109800.9 FinneganScanNumber: 1431
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 20
Elution from: 34.77 to 38.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 28838516.7 FinneganScanNumber: 2408
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 21
Elution from: 24.13 to 28.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11726195.9 FinneganScanNumber: 1415
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 22
Elution from: 32.77 to 36.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4268757.4 FinneganScanNumber: 2197
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 23
Elution from: 32.77 to 36.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1351974.7 FinneganScanNumber: 2198
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 24
Elution from: 32.79 to 36.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1468513.5 FinneganScanNumber: 2202
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 25
Elution from: 34.48 to 38.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4082275.4 FinneganScanNumber: 2371
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 26
Elution from: 28.49 to 32.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2150457.8 FinneganScanNumber: 1829
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 27
Elution from: 36.31 to 40.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2675006.6 FinneganScanNumber: 2644
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 28
Elution from: 22.50 to 26.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2815886.8 FinneganScanNumber: 1276
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 29
Elution from: 30.37 to 34.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 33408330.1 FinneganScanNumber: 1980
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 30
Elution from: 30.40 to 34.39 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1004526.6 FinneganScanNumber: 1984
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 31
Elution from: 21.03 to 25.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 429485.5 FinneganScanNumber: 1138
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 32
Elution from: 32.93 to 36.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 406896.9 FinneganScanNumber: 2213
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 33
Elution from: 37.85 to 41.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 217878.3 FinneganScanNumber: 2904
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 34
Elution from: 21.14 to 25.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1053052.0 FinneganScanNumber: 1149
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 35
Elution from: 24.51 to 28.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 661847.2 FinneganScanNumber: 1463
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 36
Elution from: 35.09 to 39.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1647536.3 FinneganScanNumber: 2442
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 37
Elution from: 34.31 to 38.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 237807.6 FinneganScanNumber: 2348
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 38
Elution from: 34.73 to 38.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 705484.3 FinneganScanNumber: 2404
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 39
Elution from: 32.58 to 36.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11973044.1 FinneganScanNumber: 2181
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 40
Elution from: 32.73 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4742393.5 FinneganScanNumber: 2193
Score greater than 14 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 41
Elution from: 35.41 to 39.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 27169786.8 FinneganScanNumber: 2492
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 42
Elution from: 41.58 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7968940.1 FinneganScanNumber: 3212
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 43
Elution from: 41.75 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1048698.4 FinneganScanNumber: 3236
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 44
Elution from: 35.86 to 39.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2759734.3 FinneganScanNumber: 2568
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 45
Elution from: 34.65 to 38.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1152021.9 FinneganScanNumber: 2392
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 46
Elution from: 33.92 to 37.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1214749.0 FinneganScanNumber: 2302
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 47
Elution from: 38.10 to 42.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 375754.2 FinneganScanNumber: 2940
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 48
Elution from: 35.29 to 39.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 252736.8 FinneganScanNumber: 2472
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 49
Elution from: 23.89 to 27.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 761675.1 FinneganScanNumber: 1389
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 50
Elution from: 35.45 to 39.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 688196.2 FinneganScanNumber: 2500
Score greater than 14 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 51
Elution from: 35.70 to 39.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18208722.2 FinneganScanNumber: 2541
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 52
Elution from: 19.49 to 23.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4530520.8 FinneganScanNumber: 1026
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 53
Elution from: 19.56 to 23.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1763061.0 FinneganScanNumber: 1030
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 54
Elution from: 33.73 to 37.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 14370127.6 FinneganScanNumber: 2291
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 55
Elution from: 35.55 to 39.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1452857.4 FinneganScanNumber: 2515
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 56
Elution from: 20.08 to 24.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 473384.1 FinneganScanNumber: 1060
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 57
Elution from: 35.25 to 39.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4708910.9 FinneganScanNumber: 2468
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 58
Elution from: 20.55 to 24.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 264051.6 FinneganScanNumber: 1098
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 59
Elution from: 35.53 to 39.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1555827.3 FinneganScanNumber: 2510
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 60
Elution from: 36.83 to 40.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 794661.9 FinneganScanNumber: 2733
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 61
Elution from: 34.55 to 38.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1112732.5 FinneganScanNumber: 2381
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 62
Elution from: 35.02 to 39.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 959463.6 FinneganScanNumber: 2432
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 63
Elution from: 35.93 to 39.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 305937.8 FinneganScanNumber: 2577
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 64
Elution from: 28.91 to 32.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 352269.9 FinneganScanNumber: 1859
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 65
Elution from: 35.10 to 39.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47009221.3 FinneganScanNumber: 2446
Score greater than 38 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 66
Elution from: 34.61 to 38.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18762538.0 FinneganScanNumber: 2385
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 67
Elution from: 29.94 to 33.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 797557.2 FinneganScanNumber: 1951
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 68
Elution from: 40.89 to 44.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3741454.0 FinneganScanNumber: 3140
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 69
Elution from: 41.43 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1108515.3 FinneganScanNumber: 3196
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 70
Elution from: 20.53 to 24.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 340549.8 FinneganScanNumber: 1097
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 71
Elution from: 24.28 to 28.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1690275.3 FinneganScanNumber: 1429
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 72
Elution from: 24.24 to 28.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1690275.3 FinneganScanNumber: 1424
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 73
Elution from: 24.26 to 28.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 557810.8 FinneganScanNumber: 1428
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 74
Elution from: 29.31 to 33.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 467327.6 FinneganScanNumber: 1901
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 75
Elution from: 24.18 to 28.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16302880.3 FinneganScanNumber: 1419
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 76
Elution from: 25.98 to 29.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6648980.2 FinneganScanNumber: 1612
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 77
Elution from: 34.62 to 38.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9907847.3 FinneganScanNumber: 2389
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 78
Elution from: 36.20 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1552168.1 FinneganScanNumber: 2624
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 79
Elution from: 36.12 to 40.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4261695.7 FinneganScanNumber: 2612
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 80
Elution from: 41.37 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 563453.1 FinneganScanNumber: 3190
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 81
Elution from: 24.30 to 28.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4943926.5 FinneganScanNumber: 1435
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 82
Elution from: 41.36 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8499743.5 FinneganScanNumber: 3189
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 83
Elution from: 32.91 to 36.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10749771.9 FinneganScanNumber: 2211
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 84
Elution from: 36.22 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5840962.6 FinneganScanNumber: 2628
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 85
Elution from: 41.37 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 65283680.9 FinneganScanNumber: 3192
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 86
Elution from: 36.57 to 40.57 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2184194.3 FinneganScanNumber: 2690
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 87
Elution from: 18.85 to 22.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 422786.1 FinneganScanNumber: 981
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 88
Elution from: 38.17 to 42.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 298888.1 FinneganScanNumber: 2953
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 89
Elution from: 36.25 to 40.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2118322.2 FinneganScanNumber: 2631
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 90
Elution from: 35.32 to 39.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1222987.4 FinneganScanNumber: 2479
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 91
Elution from: 33.07 to 37.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11527343.2 FinneganScanNumber: 2227
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 92
Elution from: 39.10 to 43.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6211765.4 FinneganScanNumber: 3020
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 93
Elution from: 30.05 to 34.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15992220.3 FinneganScanNumber: 1959
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 94
Elution from: 24.02 to 28.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 305575137.1 FinneganScanNumber: 1400
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 95
Elution from: 30.40 to 34.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5134261.7 FinneganScanNumber: 1985
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 96
Elution from: 20.74 to 24.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 405488.9 FinneganScanNumber: 1114
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 97
Elution from: 28.76 to 32.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 219354.1 FinneganScanNumber: 1850
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 98
Elution from: 35.32 to 39.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 35018641.6 FinneganScanNumber: 2478
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 99
Elution from: 35.84 to 39.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15307057.5 FinneganScanNumber: 2565
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 100
Elution from: 40.74 to 44.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6950869.7 FinneganScanNumber: 3129
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 101
Elution from: 29.54 to 33.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 690244.7 FinneganScanNumber: 1921
Score greater than 39 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 102
Elution from: 27.90 to 31.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2331869.0 FinneganScanNumber: 1787
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 103
Elution from: 24.32 to 28.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1458955.1 FinneganScanNumber: 1438
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 104
Elution from: 16.66 to 20.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 554897.6 FinneganScanNumber: 849
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 105
Elution from: 35.38 to 39.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10942299.2 FinneganScanNumber: 2489
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 106
Elution from: 27.58 to 31.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 29443928.7 FinneganScanNumber: 1757
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 107
Elution from: 32.48 to 36.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22603013.2 FinneganScanNumber: 2172
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 108
Elution from: 27.58 to 31.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12684201.8 FinneganScanNumber: 1759
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 109
Elution from: 34.53 to 38.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10262640.5 FinneganScanNumber: 2377
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 110
Elution from: 32.62 to 36.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8477952.7 FinneganScanNumber: 2184
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 111
Elution from: 24.88 to 28.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 253994930.6 FinneganScanNumber: 1510
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 112
Elution from: 35.95 to 39.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2135162.8 FinneganScanNumber: 2583
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 113
Elution from: 18.38 to 22.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 414672.7 FinneganScanNumber: 951
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 114
Elution from: 24.83 to 28.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2431011.1 FinneganScanNumber: 1504
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 115
Elution from: 34.48 to 38.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 336624.0 FinneganScanNumber: 2373
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 116
Elution from: 24.85 to 28.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1516272.0 FinneganScanNumber: 1507
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 117
Elution from: 24.32 to 28.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1315158.5 FinneganScanNumber: 1439
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 118
Elution from: 27.22 to 31.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 587144.8 FinneganScanNumber: 1730
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 119
Elution from: 24.37 to 28.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4666686.6 FinneganScanNumber: 1444
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 120
Elution from: 27.72 to 31.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1660793.0 FinneganScanNumber: 1775
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 121
Elution from: 24.51 to 28.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1841917.0 FinneganScanNumber: 1461
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 122
Elution from: 34.06 to 38.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1870317.1 FinneganScanNumber: 2315
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 123
Elution from: 24.30 to 28.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1502483.9 FinneganScanNumber: 1436
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 124
Elution from: 34.20 to 38.17 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5010369.8 FinneganScanNumber: 2332
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 125
Elution from: 37.54 to 41.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18024308.9 FinneganScanNumber: 2857
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 126
Elution from: 37.99 to 41.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 14770719.5 FinneganScanNumber: 2931
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 127
Elution from: 26.05 to 30.05 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 554073.7 FinneganScanNumber: 1620
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 128
Elution from: 40.77 to 44.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3010687.6 FinneganScanNumber: 3132
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 129
Elution from: 24.06 to 28.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3501130.9 FinneganScanNumber: 1406
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 130
Elution from: 24.45 to 28.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3501130.9 FinneganScanNumber: 1454
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 131
Elution from: 24.08 to 28.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1428045.7 FinneganScanNumber: 1408
Score greater than 15 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 132
Elution from: 40.60 to 44.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5710006.5 FinneganScanNumber: 3121
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 133
Elution from: 24.88 to 28.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47794466.8 FinneganScanNumber: 1508
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 134
Elution from: 18.07 to 22.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 356343.6 FinneganScanNumber: 931
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 135
Elution from: 26.99 to 30.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 506244.8 FinneganScanNumber: 1715
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 136
Elution from: 30.71 to 34.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1938137.6 FinneganScanNumber: 2017
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 137
Elution from: 34.22 to 38.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12424986.4 FinneganScanNumber: 2335
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 138
Elution from: 30.67 to 34.67 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18486121.1 FinneganScanNumber: 2011
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 139
Elution from: 38.02 to 41.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4912857.8 FinneganScanNumber: 2932
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 140
Elution from: 26.99 to 30.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 110266194.4 FinneganScanNumber: 1715
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 141
Elution from: 27.74 to 31.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 110270515.8 FinneganScanNumber: 1777
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 142
Elution from: 41.60 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4406865.6 FinneganScanNumber: 3217
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 143
Elution from: 41.62 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1388848.8 FinneganScanNumber: 3218
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 144
Elution from: 19.06 to 23.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 373909.6 FinneganScanNumber: 998
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.6        68        10.1        K.VDGGI.-
Top scoring peptide matches to query 145
Elution from: 26.57 to 30.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11960866.1 FinneganScanNumber: 1665
Score greater than 13 indicates homology
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.3   1.3e+02        2165        R.GIGSK.F
  2.3   1.3e+02        2165        R.GLGSK.S
  0.9   1.9e+02        2165        K.GAVSK.E
  0.9   1.9e+02        2165        K.GGLSK.S
Top scoring peptide matches to query 146
Elution from: 40.26 to 44.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2405036.7 FinneganScanNumber: 3098
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 147
Elution from: 26.62 to 30.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4965822.1 FinneganScanNumber: 1672
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 148
Elution from: 35.34 to 39.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1866105.1 FinneganScanNumber: 2481
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 149
Elution from: 33.45 to 37.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10188600.1 FinneganScanNumber: 2264
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 150
Elution from: 41.62 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1697068.4 FinneganScanNumber: 3219
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 151
Elution from: 18.07 to 22.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 207042.3 FinneganScanNumber: 934
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 152
Elution from: 30.73 to 34.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 243775.6 FinneganScanNumber: 2020
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 153
Elution from: 31.69 to 35.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 599999.9 FinneganScanNumber: 2107
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 154
Elution from: 31.80 to 35.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 334323.3 FinneganScanNumber: 2121
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 155
Elution from: 16.53 to 20.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 655666.8 FinneganScanNumber: 838
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 156
Elution from: 26.97 to 30.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 589824.2 FinneganScanNumber: 1711
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 157
Elution from: 24.69 to 28.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22250271.3 FinneganScanNumber: 1487
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 158
Elution from: 24.67 to 28.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22250271.3 FinneganScanNumber: 1485
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 159
Elution from: 41.69 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 667544.9 FinneganScanNumber: 3228
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 160
Elution from: 24.77 to 28.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 449109.5 FinneganScanNumber: 1496
Score greater than 16 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.2        35        2111        AAGVR
  6.2        35        2111        AGAVR
  6.2        35        2111        GAAVR
  2.9        74        2135        R.ASPAK.Q
  2.9        74        2135        K.GTPAK.T
  2.4        83        2135        R.QAVVG.-
  0.6   1.3e+02        2111        GVAAR
  0.6   1.3e+02        2111        VGAAR
Top scoring peptide matches to query 161
Elution from: 33.60 to 37.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2069618.6 FinneganScanNumber: 2282
Score greater than 19 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
  7.9        28        2133                    AAGVR
  6.5        39        2133                    VAAGR
  6.5        39        2133                    VAGAR
  6.5        39        2133                    VGAAR
  6.0        44        2133   27   IPI00007675 AAVGR
  6.0        44        2133                    R.AAVXR.K
  5.0        54       -3.75                    K.AALSL.-
Top scoring peptide matches to query 162
Elution from: 25.76 to 29.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1671262.2 FinneganScanNumber: 1588
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 163
Elution from: 25.81 to 29.81 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 605580.0 FinneganScanNumber: 1593
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 164
Elution from: 25.98 to 29.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10066620.6 FinneganScanNumber: 1615
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 165
Elution from: 33.92 to 37.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 86815421.2 FinneganScanNumber: 2303
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 166
Elution from: 34.02 to 38.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 40475984.9 FinneganScanNumber: 2312
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 167
Elution from: 24.97 to 28.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 717743.8 FinneganScanNumber: 1519
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 168
Elution from: 22.99 to 26.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 566071.4 FinneganScanNumber: 1330
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 169
Elution from: 34.28 to 38.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1865655.0 FinneganScanNumber: 2343
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 170
Elution from: 29.17 to 33.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2412496.4 FinneganScanNumber: 1889
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 171
Elution from: 29.17 to 33.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2396567.1 FinneganScanNumber: 1889
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 172
Elution from: 41.73 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 648297.8 FinneganScanNumber: 3234
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 173
Elution from: 41.73 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 871174.8 FinneganScanNumber: 3233
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 174
Elution from: 34.36 to 38.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 662349.4 FinneganScanNumber: 2353
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 175
Elution from: 30.84 to 34.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 327896.3 FinneganScanNumber: 2029
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 176
Elution from: 26.95 to 30.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2945261.3 FinneganScanNumber: 1709
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 177
Elution from: 40.53 to 44.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4056346.1 FinneganScanNumber: 3116
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 178
Elution from: 36.64 to 40.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1199984.8 FinneganScanNumber: 2702
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.5       2.1      -12.65        ALAGR
 14.5       3.4      -12.71        GVVGR
 14.3       3.5      -12.65        K.IAAGR.A
 10.1       9.2        10.4        K.GPVSK.Y
  9.9       9.7      -12.65        K.AIGAR.N
  9.9       9.7      -12.65        ALGAR
  8.4        14        10.4        R.GNAIL.-
  8.4        14      -12.65        GAIAR
  8.4        14      -12.65        GALAR
  8.4        14      -12.65        GIAAR
Top scoring peptide matches to query 179
Elution from: 34.20 to 38.17 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19969703.2 FinneganScanNumber: 2331
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 180
Elution from: 27.90 to 31.88 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1255729.0 FinneganScanNumber: 1785
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 181
Elution from: 30.44 to 34.44 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1263672.1 FinneganScanNumber: 1992
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 182
Elution from: 26.97 to 30.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 697410.2 FinneganScanNumber: 1710
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 183
Elution from: 25.95 to 29.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 678707.0 FinneganScanNumber: 1609
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 184
Elution from: 34.26 to 38.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5927219.2 FinneganScanNumber: 2340
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 185
Elution from: 34.31 to 38.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5936562.1 FinneganScanNumber: 2350
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 186
Elution from: 34.26 to 38.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15416222.3 FinneganScanNumber: 2340
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 187
Elution from: 30.61 to 34.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 17621530.0 FinneganScanNumber: 2005
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 188
Elution from: 35.67 to 39.67 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10092635.8 FinneganScanNumber: 2536
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 189
Elution from: 37.81 to 41.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9759834.0 FinneganScanNumber: 2897
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 190
Elution from: 35.67 to 39.67 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 13002533.4 FinneganScanNumber: 2536
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 191
Elution from: 38.69 to 42.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4604633.7 FinneganScanNumber: 2992
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.2        47        1987        GKAAR
  4.2        47        1987        KGAAR
Top scoring peptide matches to query 192
Elution from: 34.72 to 38.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 13673168.3 FinneganScanNumber: 2400
Score greater than 13 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.8        82        2009        K.AINGK.Y
  1.8        82        2009        K.ALNGK.V
  1.8        82        2009        ANLGK
  0.5   1.1e+02        2009        VNAAK
  0.4   1.1e+02        2009        R.QGIGK.G
Top scoring peptide matches to query 193
Elution from: 24.11 to 28.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 287955.4 FinneganScanNumber: 1413
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 194
Elution from: 21.36 to 25.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 207124.1 FinneganScanNumber: 1166
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 195
Elution from: 21.36 to 25.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2136585.8 FinneganScanNumber: 1164
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 196
Elution from: 21.36 to 25.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 767311.0 FinneganScanNumber: 1167
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 197
Elution from: 35.23 to 39.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3825362.6 FinneganScanNumber: 2464
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 198
Elution from: 26.27 to 30.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 286381.6 FinneganScanNumber: 1638
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 199
Elution from: 36.79 to 40.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3326994.2 FinneganScanNumber: 2727
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.2       9.9        1942        K.IANPV.-
Top scoring peptide matches to query 200
Elution from: 37.33 to 41.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1804457.5 FinneganScanNumber: 2819
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 201
Elution from: 31.58 to 35.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2017559.7 FinneganScanNumber: 2096
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.2        15        1957        AAPTR
  6.7        16        1957        R.APART.-
  5.2        23        1957        APTAR
  4.4        28       -0.04        GGARR
  4.4        28       -0.04        -.XGARR.G
  4.4        28       -0.04        GGRAR
  2.6        42        1957        -.XPSGR.Q
  2.6        42        1957        K.VSPGR.T
  2.0        49        1957        GSPVR
  2.0        49        1957        -.XATAR.A
Top scoring peptide matches to query 202
Elution from: 25.98 to 29.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 21605149.1 FinneganScanNumber: 1613
Score greater than 30 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.8      0.64        1959        VSGPR
 16.4       1.8        1959        VGSPR
  9.1       9.6        1959        K.VSPGR.T
  6.1        19        1959        AATPR
  6.1        19        1959        ATAPR
  6.1        19        1959        K.SGVPR.A
  6.0        19        1959        -.XATAR.A
  6.0        19        1959        -.PGXVR.X
  4.8        25        1959        SPGVR
  4.8        25        1959        SPVGR
Top scoring peptide matches to query 203
Elution from: 41.56 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 500519.0 FinneganScanNumber: 3209
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 204
Elution from: 35.73 to 39.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8245632.2 FinneganScanNumber: 2544
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 205
Elution from: 41.64 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 825330.2 FinneganScanNumber: 3222
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 206
Elution from: 41.54 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2166656.1 FinneganScanNumber: 3205
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 207
Elution from: 41.52 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2166656.1 FinneganScanNumber: 3201
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 208
Elution from: 41.62 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2166656.1 FinneganScanNumber: 3220
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 209
Elution from: 22.58 to 26.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 29206693.1 FinneganScanNumber: 1285
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 210
Elution from: 34.73 to 38.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 719933.3 FinneganScanNumber: 2405
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 211
Elution from: 40.41 to 44.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12505398.0 FinneganScanNumber: 3109
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 212
Elution from: 23.67 to 27.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 926858.6 FinneganScanNumber: 1370
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 213
Elution from: 35.01 to 39.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2589399.7 FinneganScanNumber: 2430
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 214
Elution from: 20.32 to 24.32 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 608756.0 FinneganScanNumber: 1078
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 215
Elution from: 34.26 to 38.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1200345.5 FinneganScanNumber: 2342
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.0        26        1862        GKDSK
  7.0        26        1896        NAMAK
  6.5        29      -17.98        R.GMAIK.D
  5.5        37        1862        K.SNVSK.I
  5.3        39        16.9        DSVSK
  5.1        41        1862        K.SNSVK.K
  4.9        43        16.9        DSSVK
  4.9        43        1862        NSSVK
  4.7        45        1862        R.SATGAK.S
  4.7        45        1862        R.SQTAK.E
Top scoring peptide matches to query 216
Elution from: 21.72 to 25.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2257354.7 FinneganScanNumber: 1193
Score greater than 15 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.2        54       -4.54        K.AYGPK.V
Top scoring peptide matches to query 217
Elution from: 22.62 to 26.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1797187.1 FinneganScanNumber: 1292
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8        15        3.12        STATR
  7.8        15        3.12        R.STTAR.N
  6.2        21        3.12        SSVSR
  6.2        21        3.12        SVSSR
Top scoring peptide matches to query 218
Elution from: 22.42 to 26.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 771023.9 FinneganScanNumber: 1266
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 219
Elution from: 36.38 to 40.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4872116.5 FinneganScanNumber: 2655
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 220
Elution from: 22.81 to 26.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5366763.9 FinneganScanNumber: 1309
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 221
Elution from: 36.49 to 40.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2767389.0 FinneganScanNumber: 2675
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 222
Elution from: 41.54 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2022517.6 FinneganScanNumber: 3208
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 223
Elution from: 41.54 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 13390728.2 FinneganScanNumber: 3207
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 224
Elution from: 20.70 to 24.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 280868.3 FinneganScanNumber: 1110
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.4        28        1875        R.DFGAK.T
  3.5        34        1854        K.AYAGR.K
  3.5        34        1854        R.FSAGR.H
  3.5        34        1854        R.FSGAR.K
  3.5        34        1854        R.GGTFR.R
  3.5        34        1854        K.SFGAR.L
Top scoring peptide matches to query 225
Elution from: 16.55 to 20.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1030910.7 FinneganScanNumber: 841
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 226
Elution from: 20.80 to 24.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 309562.8 FinneganScanNumber: 1121
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 227
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 512732.0 FinneganScanNumber: 3087
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 228
Elution from: 35.61 to 39.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6692006.2 FinneganScanNumber: 2522
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 229
Elution from: 35.38 to 39.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18598953.7 FinneganScanNumber: 2488
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 230
Elution from: 35.65 to 39.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4100543.3 FinneganScanNumber: 2530
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.2        17       -9.41        K.NVSPK.K
Top scoring peptide matches to query 231
Elution from: 35.79 to 39.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10597747.6 FinneganScanNumber: 2555
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 232
Elution from: 26.27 to 30.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 523275.4 FinneganScanNumber: 1637
Score greater than 22 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.9         3        1801        K.IPDGR.N
  9.9         3        1801        -.XPDGR.L
  9.9         3        1801        LPDGR
  9.9         3        1801        -.XPDGR.L
  9.9         3        12.2        R.SPAAGR.A
  9.3       3.4        1801        DLGPR
  9.3       3.4        1801        DVAPR
  9.3       3.4        12.2        K.NATPR.T
  8.6       4.1        1801        LDPGR
  7.0       5.9        1801        DLPGR
Top scoring peptide matches to query 233
Elution from: 21.49 to 25.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1106704.5 FinneganScanNumber: 1174
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.8       8.9        1795        R.GAEGAR.G
  8.6        14        15.5        K.GGGGSAR.Y
  7.7        18        15.5        R.GGSGQR.R
  5.4        30        15.5        R.SGNQR.Q
  4.9        34        1795        M.AGAGER.K
  4.9        34        1795        AGEQR
  4.9        34        1795        R.EAGAGR.V
  4.9        34        1795        EAGQR
  4.9        34        1795        EGAQR
  4.9        34        1795        EQAGR
Top scoring peptide matches to query 234
Elution from: 35.84 to 39.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15542773.7 FinneganScanNumber: 2563
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.1       7.1        1784        MALVK
  7.6        10        7.94        MGKVK
  6.8        12        1784        MVALK
  2.1        36        7.94        MVKGK
Top scoring peptide matches to query 235
Elution from: 35.99 to 39.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15542773.7 FinneganScanNumber: 2589
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.5        20        1797        K.QKKAS.-
  4.5        21        1797        K.KQAKS.-
  4.5        21        1797        KQASK
  4.5        21        1797        K.QKASK.E
  1.9        38        1797        KSQAK
  1.9        38        1797        QSKAK
  0.9        47        1797        SQKAK
  0.9        47        1797        QKSAK
Top scoring peptide matches to query 236
Elution from: 28.01 to 32.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 413822.8 FinneganScanNumber: 1798
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 237
Elution from: 23.67 to 27.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 437412.8 FinneganScanNumber: 1371
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 238
Elution from: 36.64 to 40.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 2701
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.2        29       -1.01        VTPPR
Top scoring peptide matches to query 239
Elution from: 37.99 to 41.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2550761.4 FinneganScanNumber: 2930
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 240
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1361423.6 FinneganScanNumber: 3086
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 241
Elution from: 36.56 to 40.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 749633.3 FinneganScanNumber: 2684
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 242
Elution from: 21.03 to 25.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 824414.7 FinneganScanNumber: 1139
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4        15        11.4        R.STNPR.A
  3.3        39        1750        K.TNNPK.E
  3.0        42       -8.19        DRGAR
  2.5        47        11.4        STPNR
  2.5        47        11.4        -.XTPNR.R
  2.4        48        11.4        R.TSPGGR.T
  2.1        52        11.4        R.AEAGAR.A
  1.5        59        1750        -.XSQPK.S
  1.2        64        11.4        K.SPSAGR.K
  1.2        64        11.4        SPSQR
Top scoring peptide matches to query 243
Elution from: 29.13 to 33.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11074793.4 FinneganScanNumber: 1883
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 12.1       3.6        1761                    DVPSR
  8.9       7.6        8.98                    R.GPAMAK.G
  7.6        10        1761                    DPVSR
  7.1        11        1761                    K.LAQNQ.-
  5.4        17        1761                    DVSPR
  1.7        40        1761   28   IPI00022881 R.NPTGGK.L
  1.7        40        1761                    R.NGSPAK.L
  1.6        40        1741                    R.GGLGGGR.E
  1.6        40        1741                    K.NINGR.Q
  1.6        40        1741                    R.NLGGGR.G
Top scoring peptide matches to query 244
Elution from: 33.31 to 37.30 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 380811.8 FinneganScanNumber: 2253
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 245
Elution from: 25.12 to 29.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1456893.3 FinneganScanNumber: 1538
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 246
Elution from: 33.03 to 37.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3949489.5 FinneganScanNumber: 2224
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 247
Elution from: 38.14 to 42.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1401306.2 FinneganScanNumber: 2945
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 248
Elution from: 38.14 to 42.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 900331.3 FinneganScanNumber: 2947
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 249
Elution from: 30.71 to 34.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 568335.1 FinneganScanNumber: 2019
Score greater than 17 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.4       9.5        1.89        R.AGGGGHK.L
  4.8        11        1.92        SSHPR
  4.3        12        1.89        K.DGHVR.Q
  4.0        13        1.92        R.SSPHR.W
Top scoring peptide matches to query 250
Elution from: 22.85 to 26.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 290583.0 FinneganScanNumber: 1316
Score greater than 13 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.2        32        11.5        K.HAISR.G
Top scoring peptide matches to query 251
Elution from: 38.14 to 42.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1096906.6 FinneganScanNumber: 2944
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.2        12        4.15        K.LKVHS.-
Top scoring peptide matches to query 252
Elution from: 36.31 to 40.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16548807.7 FinneganScanNumber: 2641
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 253
Elution from: 36.20 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 17166670.5 FinneganScanNumber: 2622
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.1        31      -17.13        K.AGGARR.S
Top scoring peptide matches to query 254
Elution from: 36.31 to 40.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4170875.3 FinneganScanNumber: 2641
Score greater than 15 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.0        43       -7.78        R.GAEALK.G
  2.0        85       -7.78        K.AGEALK.G
  1.4        98       -7.78        R.ELQKA.-
  1.0   1.1e+02        15.9        K.GRAER.R
  0.7   1.1e+02       -7.78        K.GEAALK.I
  0.6   1.2e+02       -7.84        R.GVGDIK.I
  0.1   1.3e+02        15.9        R.GRNNK.D
Top scoring peptide matches to query 255
Elution from: 36.49 to 40.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 128344189.2 FinneganScanNumber: 2673
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 256
Elution from: 38.17 to 42.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 128439608.7 FinneganScanNumber: 2954
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 257
Elution from: 24.97 to 28.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 286168.4 FinneganScanNumber: 1518
Score greater than 18 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1        41        1708        K.VVTAAK.E
  5.8        44        1689        LAKTR
  5.0        53        13.2        K.KAAATK.K
  0.2   1.6e+02        1708        K.LSVAAK.R
  0.0   1.7e+02        1708        EKIAK
  0.0   1.7e+02        1708        EKLAK
  0.0   1.7e+02        1708        R.GLSLAK.A
  0.0   1.7e+02        1708        KELAK
  0.0   1.7e+02        1689        R.RTIAK.Y
  0.0   1.7e+02        1708        K.SAVIAK.N
Top scoring peptide matches to query 258
Elution from: 29.08 to 33.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 558499.2 FinneganScanNumber: 1878
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 259
Elution from: 29.08 to 33.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 420663.1 FinneganScanNumber: 1879
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.4        14        1702        K.KGVHR.C
  3.9        16        1702        R.KHGVR.V
Top scoring peptide matches to query 260
Elution from: 39.42 to 43.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3735712.1 FinneganScanNumber: 3043
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 261
Elution from: 22.45 to 26.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 424815.6 FinneganScanNumber: 1270
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 262
Elution from: 22.95 to 26.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8680517.7 FinneganScanNumber: 1322
Score greater than 20 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.9       3.7        4.66        TIIPR
  9.9       3.7        4.66        R.TLIPR.Y
  9.9       3.7        4.66        TLLPR
  7.3       6.6        4.66        R.TPLLR.Q
  2.9        18        4.66        K.TLPIR.S
  2.9        18        4.66        TLPLR
  1.4        26        4.66        R.IITPR.L
  1.4        26        4.66        R.ILTPR.R
  1.4        26        4.66        LLTPR
  1.1        28        4.66        K.VGKAPK.S
Top scoring peptide matches to query 263
Elution from: 24.54 to 28.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7933812.9 FinneganScanNumber: 1467
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.3       4.2        5.52        TIIPR
  9.3       4.2        5.52        R.TLIPR.Y
  9.3       4.2        5.52        TLLPR
  9.3       4.2        5.52        K.TLPIR.S
  9.3       4.2        5.52        TLPLR
  5.2        11        1695        RGLPR
  5.2        11        1695        R.RGPLR.A
  1.8        24        5.52        K.ITIPR.G
  1.8        24        5.52        R.LTIPR.K
  1.8        24        5.52        LTLPR
Top scoring peptide matches to query 264
Elution from: 22.97 to 26.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2526081.4 FinneganScanNumber: 1326
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.4       6.7        1681        K.ITIPR.G
 11.4       6.7        1681        R.LTIPR.K
 11.4       6.7        1681        LTLPR
 10.5       8.3        1681        TIIPR
 10.5       8.3        1681        R.TLIPR.Y
 10.5       8.3        1681        TLLPR
  9.7        10        1681        K.TLPIR.S
  9.7        10        1681        TLPLR
  6.1        23        1681        K.VGKAPK.S
  5.4        27        1681        K.LTPIR.E
Top scoring peptide matches to query 265
Elution from: 33.51 to 37.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 334924.9 FinneganScanNumber: 2273
Score greater than 24 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.2        13        1658        R.KEPTK.E
 10.4        16        3.26        K.IQNTK.L
 10.4        16        3.26        LQNTK
  8.4        25        3.26        K.KLNTQ.-
  8.0        28        3.26        QISQK
  8.0        28        3.26        R.QLSGAK.K
  8.0        28        3.26        R.QLSQK.L
  5.7        47        3.29        R.EAKAGK.L
  5.7        47        3.29        EAKQK
  5.7        47        3.29        K.EAQKK.R
Top scoring peptide matches to query 266
Elution from: 33.47 to 37.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7407005.6 FinneganScanNumber: 2267
Score greater than 31 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 24.4       0.4        1673        QISQK
 24.4       0.4        1673        R.QLSGAK.K
 24.4       0.4        1673        R.QLSQK.L
 17.2       2.1        1673        LQSQK
 11.5       7.7        1673        K.IAGTNK.G
 11.5       7.7        1673        R.LQTNK.E
 11.4       7.9        1673        K.NITQK.R
 11.1       8.6       -9.81        K.KIGMR.E
 11.1       8.6        1673        K.KLNTQ.-
 11.1       8.6        1673        QIQSK
Top scoring peptide matches to query 267
Elution from: 21.19 to 25.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 468444.2 FinneganScanNumber: 1153
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 268
Elution from: 36.57 to 40.57 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7335966.3 FinneganScanNumber: 2689
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 269
Elution from: 31.73 to 35.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 347590.8 FinneganScanNumber: 2112
Score greater than 15 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.3       6.5        1655        R.YIAIK.K
  6.3       6.5        1655        R.YLAIK.Q
  1.8        18        1655        LYALK
Top scoring peptide matches to query 270
Elution from: 31.75 to 35.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 32437560.0 FinneganScanNumber: 2116
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 271
Elution from: 26.64 to 30.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 325023.9 FinneganScanNumber: 1675
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.3        12        1633        GHLER
  3.8        13        1632        K.GPGAGPR.R
  1.4        22        1632        K.GPQGPR.G
  1.0        24        1633        R.ANPGPR.S
  0.2        29        1632        THTPR
Top scoring peptide matches to query 272
Elution from: 26.66 to 30.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 168357.0 FinneganScanNumber: 1678
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 273
Elution from: 35.65 to 39.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2618974.6 FinneganScanNumber: 2533
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.6       5.7      -15.68        R.APRGGR.G
  9.6       5.7      -15.68        R.ARPGGR.E
  9.3         6        1631        R.IHAGSK.T
  8.8       6.8        1631        IHTGGK
  8.8       6.8        1631        LHTNK
  8.8       6.8        1631        K.LTHNK.D
  5.6        14        2.66        R.GGPLNR.V
  5.6        14        2.68        K.NPINR.I
  5.5        14        1631        R.KPPDR.S
  4.5        18        1631        R.DRPPK.Q
Top scoring peptide matches to query 274
Elution from: 21.56 to 25.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 476692.1 FinneganScanNumber: 1184
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.8      0.72        0.16        ILVDR
 21.8      0.72        0.16        R.LLVDR.F
 11.5       7.7        0.16        ILDVR
 11.5       7.7        0.16        R.LLDVR.S
 10.5       9.7        0.16        K.IVIDR.E
 10.5       9.7        0.16        LVLDR
 10.3        10        0.16        R.IIGGQK.A
 10.3        10        0.19        R.IINQK.Q
 10.3        10        0.19        K.IIQNK.K
 10.3        10        0.19        LLNQK
Top scoring peptide matches to query 275
Elution from: 37.12 to 41.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1197838.4 FinneganScanNumber: 2780
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.9        15        1636        K.KSGSSR.R
Top scoring peptide matches to query 276
Elution from: 41.86 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3490426.0 FinneganScanNumber: 3243
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.2       5.2        6.78        K.AYNKK.T
 11.2       5.2        6.76        K.FSXKK.L
 11.2       5.2        6.76        R.HPLEK.E
 11.0       5.5        6.76        R.IPEHK.S
 11.0       5.5        6.76        LPEHK
 10.9       5.5        6.76        K.LPHEK.H
  7.5        12        6.73        R.FSKGGK.T
  7.5        12        6.76        HPEIK
  7.5        12        6.76        HPELK
  7.5        12        6.76        K.SFKNK.G
Top scoring peptide matches to query 277
Elution from: 40.36 to 44.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 663528.5 FinneganScanNumber: 3104
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 278
Elution from: 40.36 to 44.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 348182.1 FinneganScanNumber: 3105
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 279
Elution from: 35.23 to 39.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 515514.2 FinneganScanNumber: 2466
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 280
Elution from: 20.44 to 24.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 306150.3 FinneganScanNumber: 1087
Score greater than 23 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 22.7      0.17        1.38                    K.AAFYR.K
  8.9       4.1        1.38    1   IPI00301263 AAYFR
  0.9        26        1617                    R.ELIDH.-
Top scoring peptide matches to query 281
Elution from: 29.93 to 33.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22248933.7 FinneganScanNumber: 1950
Score greater than 25 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.4       7.2        1585        M.TLGSPR.K
 11.7        11        1584        K.TGTVPR.V
 11.7        11        1585        R.ATSVPR.W
 11.4        11        1585        R.EGVLGR.R
 11.4        11        1585        K.GTSLPR.A
 11.4        11        1585        R.TGSLPR.K
 11.4        11        1585        -.XGVALR.S
 11.4        11        1585        R.DGVIAR.D
 11.3        12        1585        K.SVTAPR.L
 11.2        12        1585        K.DAIGVR.R
Top scoring peptide matches to query 282
Elution from: 31.43 to 35.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19660006.3 FinneganScanNumber: 2085
Score greater than 23 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6        11        3.19        R.AGLGRGT.-
 11.4        11        1595        MAPRR
 11.4        11        1595        MPARR
  9.8        17        3.19        R.QLGGTR.L
  9.4        18        1585        SSALPR
  7.5        28        1585        R.SPGTLR.V
  7.3        30       -8.53        K.IMVPR.T
  7.3        30       -8.53        LMVPR
  7.0        32        1613        -.MGLGPR.S
  6.9        32        1585        R.SLTGPR.S
Top scoring peptide matches to query 283
Elution from: 33.94 to 37.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7396471.8 FinneganScanNumber: 2306
Score greater than 21 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.6       2.2        3.22        R.LTGGQR.L
  7.5        28        3.24        K.ATVNAR.A
  6.7        34        3.24        LASQGR
  6.5        35        1585        R.DGVIAR.D
  6.3        37        3.24        R.SALGGAR.E
  6.2        38        1585        R.SPSALR.G
  6.1        38        3.24        R.ASGLGAR.E
  6.1        39        3.24        K.SAIGQR.I
  6.1        39        3.22        K.GDVGKR.R
  6.0        40        3.22        R.DVGGKR.R
Top scoring peptide matches to query 284
Elution from: 22.81 to 26.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 482083.9 FinneganScanNumber: 1308
Score greater than 22 indicates homology
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.6        22      -16.71        K.KLGASR.T
  9.3        29      -16.71        K.VKASAR.A
  9.3        29        1605        KANAAR
  8.8        33        1605        K.AKANAR.A
  6.6        54      -16.71        K.KLRQS.-
  6.3        57        1.10        R.QAALTK.L
  6.0        62      -16.71        R.KIQSR.Q
  6.0        62      -16.71        KLQSR
  6.0        62      -16.71        K.QLKSR.L
  6.0        63        1.13        K.KIEKN.-
Top scoring peptide matches to query 285
Elution from: 31.33 to 35.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5783697.2 FinneganScanNumber: 2074
Score greater than 21 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.2        10        1595        R.SQIQR.A
 12.2        10        1595        R.SQLGAR.A
 12.2        10        1595        SQLQR
 12.0        11        1595        R.AGLGRGT.-
 11.8        11        1583        K.IMVPR.T
 11.8        11        1583        LMVPR
  8.0        27        1595        K.AAVQSR.E
  7.9        28        1595        R.IQQSR.R
  7.6        30        1595        R.NLAASR.A
  7.5        30        1595        K.GGTLQR.S
Top scoring peptide matches to query 286
Elution from: 38.24 to 42.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 50398112.5 FinneganScanNumber: 2961
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 287
Elution from: 21.36 to 25.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 205616.0 FinneganScanNumber: 1165
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.0        25      -15.60        -.MPGAMK.I
  3.6        28      -15.62        K.MPVCK.G
  3.6        28       -3.94        K.NNVCK.N
Top scoring peptide matches to query 288
Elution from: 38.24 to 42.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12213963.9 FinneganScanNumber: 2961
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 289
Elution from: 37.30 to 41.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 2815
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 290
Elution from: 32.89 to 36.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11247808.7 FinneganScanNumber: 2209
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1        17        1603        R.MISKR.N
  6.1        17        1603        MLSKR
  6.1        17        1603        -.MSLKR.S
  1.5        48        1603        MRISK
  1.5        48        1603        MRLSK
  1.5        48        1603        K.MRSIK.A
  1.5        48        1603        MRSLK
  1.5        48        1603        R.MRTVK.N
  0.9        55        1603        K.RIMAK.A
  0.9        55        1603        K.RLMAK.C
Top scoring peptide matches to query 291
Elution from: 32.84 to 36.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11247808.7 FinneganScanNumber: 2206
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.6       9.4        1603        R.RIAXK.I
  8.6       9.4        1603        K.RLAMK.Q
  8.6       9.5        1603        M.ISKMR.K
  8.6       9.5        1603        R.LSKMR.R
  8.0        11        1603        R.IRAMK.K
  8.0        11        1603        K.LRAMK.E
  7.8        11        1593        K.SSIISK.K
  7.2        13        1603        K.AKLMR.A
  7.2        13        1603        R.KALMR.L
  6.6        15       -2.54        R.ITFVR.K
Top scoring peptide matches to query 292
Elution from: 32.95 to 36.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11247808.7 FinneganScanNumber: 2216
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.3         8        1603        MSKIR
  9.3         8        1603        MSKLR
  9.3         8        1603        -.MSLKR.S
  6.8        14        1603        K.KIAMR.E
  6.8        14        1603        R.KLAMR.L
  6.8        14        1603        K.LKAMR.A
  6.2        16        1575        K.SSKGKK.K
  5.6        19        1603        R.MISKR.N
  5.6        19        1603        MKISR
  5.6        19        1603        K.MKIXR.F
Top scoring peptide matches to query 293
Elution from: 18.53 to 22.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 906502.0 FinneganScanNumber: 960
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 294
Elution from: 15.94 to 19.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 184806.7 FinneganScanNumber: 805
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 17.9      0.27        3.46    1   IPI00301263 RVVLR
 12.7      0.91        3.46                    K.RVIVR.K
 12.7      0.91        3.46                    RVLVR
 11.3       1.2        1558                    K.KPIKR.V
 11.3       1.2        1558                    KPLKR
  7.0       3.4        3.46                    LVVRR
  7.0       3.4        3.46                    VLVRR
  7.0       3.4        3.46                    K.VVIRR.L
  7.0       3.4        3.46                    VVLRR
  5.2       5.1        3.46                    K.VRVIR.L
Top scoring peptide matches to query 295
Elution from: 37.95 to 41.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 2926
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 296
Elution from: 7.19 to 11.20 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4570359.9 FinneganScanNumber: 412
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 297
Elution from: 3.92 to 7.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3021194.1 FinneganScanNumber: 273
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 298
Elution from: 32.34 to 36.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1247875.6 FinneganScanNumber: 2161
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.1      0.97        1553        K.GSPAGGAK.T
 11.2       4.8        1553        R.SSHVSK.R
  9.3       7.3       -0.08        K.SAGPWK.M
  9.3       7.3       -0.08        R.SPQWK.F
  8.1       9.7        17.4        R.YTFSK.M
  8.0        10        1553        GSPVER
  7.8        11        1553        K.SPQGQK.L
  7.5        11       -5.31        R.IHTMK.Y
  7.3        12       -6.36        K.FFGFK.F
  7.2        12        1553        K.SAGPGQK.L
Top scoring peptide matches to query 299
Elution from: 32.36 to 36.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 276168.3 FinneganScanNumber: 2164
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.7        24       -2.87        K.ALEGEK.S
  5.8        30       -2.87        K.EVAEAK.V
  5.7        31       -2.87        K.ADIEAK.S
  5.7        31       -2.87        K.ELGEAK.K
  5.3        34        1.27        R.GSRGNR.G
  4.4        41        12.4        R.STRPW.-
  2.4        66       -2.87        K.DLAAEK.S
  2.2        69       -2.92        K.VSDPTK.L
  1.7        77       -2.87        R.AAVEEK.R
  1.7        77       -2.87        K.AEGIEK.S
Top scoring peptide matches to query 300
Elution from: 40.26 to 44.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 650550.4 FinneganScanNumber: 3096
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 301
Elution from: 40.26 to 44.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 428947.2 FinneganScanNumber: 3097
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 302
Elution from: 38.24 to 42.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1133941.4 FinneganScanNumber: 2959
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.1        19       -8.86        R.NTATIK.W
  3.8        64        6.47        R.SKAWR.C
  2.2        93        1572        R.LTAEGR.G
  0.1   1.5e+02        6.47        K.KSAWR.K
Top scoring peptide matches to query 303
Elution from: 24.77 to 28.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 432952.3 FinneganScanNumber: 1493
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.9        40        1531        K.VTSGMR.V
  3.1        48        1531        K.VTMQR.V
  2.6        54        1536        R.EAFQR.L
  2.6        54        1531        EAMKR
  2.6        54        1531        R.EAMRK.L
  1.9        63        2.96        R.GYGAQR.A
  1.4        71        2.93        -.XSGFGAR.L
  1.3        72        1531        MGGKNK
  1.3        73        1531        EMSKR
  1.3        73        1548        EMKDK
Top scoring peptide matches to query 304
Elution from: 31.15 to 35.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 665860.8 FinneganScanNumber: 2054
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 305
Elution from: 31.15 to 35.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7435451.7 FinneganScanNumber: 2055
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.4        53        1560        K.SSRMR.N
Top scoring peptide matches to query 306
Elution from: 41.02 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10065132.8 FinneganScanNumber: 3158
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 307
Elution from: 41.33 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18615211.1 FinneganScanNumber: 3186
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 308
Elution from: 41.33 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 24465074.8 FinneganScanNumber: 3187
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 309
Elution from: 41.18 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5442535.4 FinneganScanNumber: 3173
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 310
Elution from: 32.73 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4955692.4 FinneganScanNumber: 2191
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 311
Elution from: 38.27 to 42.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 570800.4 FinneganScanNumber: 2966
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.7        15        18.4        K.TVHQGK.A
Top scoring peptide matches to query 312
Elution from: 24.38 to 28.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4109800.9 FinneganScanNumber: 1448
Score greater than 29 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.4       1.4       -1.12        K.TVSIPR.S
 18.6       1.6      -17.82        R.KAQGIR.T
 18.6       1.6      -17.82        R.KAQGLR.S
 15.4       3.4       -1.09        K.SISLPR.S
 15.4       3.4       -1.09        R.SLSLPR.I
 15.1       3.6       -1.07        R.EALALR.L
 14.2       4.4       -1.09        M.SLSPLR.V
 14.1       4.6       -1.07        R.AEALIR.S
 14.1       4.6       -1.07        AEALLR
 13.3       5.5        19.6        R.RGGGGLR.G
Top scoring peptide matches to query 313
Elution from: 24.28 to 28.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4109800.9 FinneganScanNumber: 1431
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.3       5.5      -17.82        R.GAAGKIR.E
 11.7         8      -17.82        AKGAAVR
 10.4        11       -1.09        R.LSSLPR.G
 10.4        11       -1.09        K.SISLPR.S
 10.4        11       -1.09        R.SLSLPR.I
 10.4        11       -1.12        K.TVSIPR.S
 10.4        11       -1.09        K.ISISPR.T
 10.4        11       -1.09        K.LSLSPR.E
 10.4        11       -1.12        R.TVISPR.L
  9.0        15        1504        R.ATRAPR.R
Top scoring peptide matches to query 314
Elution from: 23.73 to 27.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 399058.1 FinneganScanNumber: 1379
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 315
Elution from: 23.73 to 27.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 298378.7 FinneganScanNumber: 1378
Score greater than 19 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8       3.4        15.5        R.GCGGPAR.A
  6.7       4.4      -16.83        R.SWEPR.L
  6.7       4.4      -16.83        K.SWPER.R
  5.0       6.4       -5.16        R.EAGLMPG.-
  4.2       7.8        5.79        R.GGAGADVQ.-
  3.9       8.3      -10.87        K.NGPGSSR.-
Top scoring peptide matches to query 316
Elution from: 31.29 to 35.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 48709513.8 FinneganScanNumber: 2072
Score greater than 18 indicates homology
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5        59        1495        R.EEGVLK.G
  5.0        67        16.5        K.NTIVATG.-
  3.5        94        1495        K.EDAVLK.V
  3.5        94        1472        R.EWVLK.S
  3.1     1e+02       -0.13        K.IRSGDK.S
  2.1   1.3e+02      -16.78        R.RLGSSR.R
  0.8   1.8e+02        1499        R.ARAGGSR.H
  0.7   1.8e+02        16.5        K.ATPSTAK.E
  0.4   1.9e+02        16.5        K.AGEATVK.F
  0.2     2e+02        1499        M.GARSGAR.G
Top scoring peptide matches to query 317
Elution from: 31.35 to 35.32 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 49093865.5 FinneganScanNumber: 2078
Score greater than 20 indicates homology
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2        32        1509        K.AFPPSR.A
  7.9        34        1504        -.MALPSR.I
  7.0        42        1504        R.MSLPAR.L
  6.8        44        1504        -.MSALPR.D
  6.2        50        1509        R.FAPPSR.R
  5.7        56        1504        R.SMLAPR.L
  4.0        83        1499        R.SGQARR.S
  4.0        83        1499        R.SGAQRR.R
  3.8        88        1499        M.GARSGAR.G
  3.6        92        1504        -.MAISPR.S
Top scoring peptide matches to query 318
Elution from: 34.77 to 38.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 28838516.7 FinneganScanNumber: 2408
Score greater than 21 indicates homology
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.9       6.8        1488        R.VPRMR.V
  8.0        33        1488        -.XPMRR.S
  7.6        37        0.65        R.EKAATR.R
  7.5        38        0.61        R.TVAGTAR.S
  7.4        38        0.63        K.SSKPTR.K
  6.8        44        1493        K.KGWQR.A
  6.3        49        1479        R.VEVATR.V
  5.7        57        17.3        K.NTIVATG.-
  5.5        59        1505        R.SAMPLR.D
  5.5        59        1505        K.MAPALR.K
Top scoring peptide matches to query 319
Elution from: 32.77 to 36.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 39500920.4 FinneganScanNumber: 2200
Score greater than 26 indicates homology
Score greater than 36 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 24.6      0.71        17.3        K.SKPGSSL.-
 11.7        14        0.69        K.SKTPSR.Q
 11.6        14        1510        R.FAPPSR.R
 11.4        15        1510        K.AFPPSR.A
  9.5        23        1505        -.MALPSR.I
  7.1        40        1505        -.MSALPR.D
  7.1        40        1505        R.MSLPAR.L
  6.8        43        1493        R.FHKSR.T
  6.8        43        1479        R.TLTPSR.A
  6.0        52        1499        R.GRAQSR.S
Top scoring peptide matches to query 320
Elution from: 34.12 to 38.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12797770.2 FinneganScanNumber: 2324
Score greater than 13 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.9        31       -4.63        K.SKFGIK.R
Top scoring peptide matches to query 321
Elution from: 34.10 to 38.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12797770.2 FinneganScanNumber: 2323
Score greater than 13 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.9        31        1485        K.TFRVR.S
  0.6        33        15.9        YGRRK
Top scoring peptide matches to query 322
Elution from: 34.09 to 38.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12797770.2 FinneganScanNumber: 2318
Score greater than 17 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.1        15        1465        K.KLAAYI.-
Top scoring peptide matches to query 323
Elution from: 37.00 to 40.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7861163.8 FinneganScanNumber: 2762
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 324
Elution from: 36.96 to 40.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7861163.8 FinneganScanNumber: 2759
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 325
Elution from: 28.51 to 32.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 520055.8 FinneganScanNumber: 1832
Score greater than 30 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 27.3      0.25        10.4        -.MEAVNK.L
 15.5       3.9        1438        K.MEAAIR.E
 15.5       3.9        1438        -.MEALAR.L
 15.5       3.9        1474        -.MQANAR.L
 15.3         4        10.4        -.MEGINK.T
 13.2       6.6        1438        R.MAVQGGK.G
 12.9       7.1        1438        K.MVGDIR.K
 12.3         8        10.4        -.MEVGQK.D
 12.3         8        1454        K.VCADLI.-
 11.5       9.6        1465        M.NDTVNK.T
Top scoring peptide matches to query 326
Elution from: 32.95 to 36.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4268757.4 FinneganScanNumber: 2215
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.7       5.8        1469        MGLSRK
 11.7       5.8        1469        -.MGTVRK.G
 11.2       6.4        1459        R.ISSSLGK.K
 10.3       7.9        17.5        R.SKTTAGK.T
  9.8       8.9        11.7        R.VGELFK.K
  9.8       8.9        17.5        R.SSKDKK.H
  9.4       9.8        6.83        K.IATLMK.S
  9.2        10        1469        -.MSRVAK.Y
  8.7        11       -4.56        R.VFGNKK.Q
  7.7        14        1469        -.MAVSRK.D
Top scoring peptide matches to query 327
Elution from: 32.77 to 36.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4268757.4 FinneganScanNumber: 2197
Score greater than 31 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.1      0.83        1469        -.MAGLKR.R
 17.8       1.4        1443        R.STLKSR.S
 17.7       1.5        1469        -.MSGIKR.T
 17.1       1.7        1469        -.MAGKLR.K
 16.6       1.8        1437        K.AFGLVGK.L
 15.8       2.2        1469        -.MGISKR.K
 15.6       2.3        1443        K.TSLKSR.V
 15.1       2.6        6.83        R.TLAMIK.I
 13.4       3.9        1443        SSTLKR
 12.9       4.3        1469        K.QRMIK.K
Top scoring peptide matches to query 328
Elution from: 38.45 to 42.44 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2735666.1 FinneganScanNumber: 2978
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8        10       -3.14        R.GTFLVR.E
  9.9        10        1444        R.TKSTVR.Y
  9.8        10       -3.14        -.XFLTVR.R
  9.8        10       -3.14        K.VAFTVR.K
  7.4        18        1461        K.TGIVSSK.I
  7.3        18        8.27        K.MILATK.Q
  7.3        18        8.27        -.MTAIIK.E
  5.5        27        1438        R.IFGINK.Y
  5.5        27        1438        R.IGFLNK.H
  2.4        56        1470        R.KGTMVR.W
Top scoring peptide matches to query 329
Elution from: 32.77 to 36.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1351974.7 FinneganScanNumber: 2198
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.9       4.2        1463        K.GILYLN.-
  7.9        11        18.7        K.TGIMKK.A
  6.9        13        18.7        R.KTGIMK.K
  3.8        28        7.36        R.APVPGPR.R
  3.3        31        1453        K.KSSSKR.R
  3.2        31        1463        K.TAIPYK.R
Top scoring peptide matches to query 330
Elution from: 35.14 to 39.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 335638.2 FinneganScanNumber: 2451
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.0       6.2        18.6        K.GTVTYR.S
  8.1       9.6        18.7        R.EKTYR.K
  8.1       9.6        18.7        -.XSATYR.I
  7.4        11      -13.63        R.QKQHR.K
  5.7        17        2.54        K.AIAEHR.S
  5.7        17        2.49        K.VGVEHR.D
  5.7        17      -13.63        R.VREHR.G
  5.2        19      -13.63        K.DRLHR.G
  1.6        43        1452        R.GLSSGFK.Y
Top scoring peptide matches to query 331
Elution from: 29.60 to 33.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2860310.1 FinneganScanNumber: 1927
Score greater than 15 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.2       5.6        1440        K.VXTSVR.N
  1.6        33        13.3        K.VGDPRR.V
  0.3        43        1441        R.HKASQK.V
Top scoring peptide matches to query 332
Elution from: 34.48 to 38.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2542150.0 FinneganScanNumber: 2372
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.3        13        1446        MHTGEK
  4.1        18        1415        R.SSFAYK.D
  3.4        21        1430        -.MHTGTR.R
  2.9        23        1446        -.MHSAEK.V
  2.3        27        1415        K.SFFSSK.A
  1.8        30      -14.75        -.MVFYK.C
  1.8        31        1446        R.MEAHAK.F
  1.3        34       -4.22        R.WEPSGK.A
  0.3        43        1440        YGGFMK
Top scoring peptide matches to query 333
Elution from: 34.48 to 38.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2542150.0 FinneganScanNumber: 2371
Score greater than 25 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.4       1.3        1446        MHTGEK
 11.6       3.2        17.5        K.TPDGGEK.Q
 10.2       4.4        1446        R.THMGEK.V
  9.6       5.1        17.5        R.DGTPGEK.G
  8.9       5.9        1430        -.MHTGTR.R
  8.0       7.2        1.52        K.NQQGEK.L
  8.0       7.2        1.52        R.QQNGEK.I
  6.2        11       -9.00        R.MPQAEK.E
  6.0        11       -9.00        MAPEQK
  5.4        13        1446        -.MHSAEK.V
Top scoring peptide matches to query 334
Elution from: 40.14 to 44.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1889816.3 FinneganScanNumber: 3080
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 335
Elution from: 40.23 to 44.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 368456.8 FinneganScanNumber: 3091
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 336
Elution from: 32.70 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 321563.1 FinneganScanNumber: 2190
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 337
Elution from: 32.70 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1272346.9 FinneganScanNumber: 2189
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.5        19        1403        K.DPGPGGGR.D
  3.3        20        1403        K.NQDHAK.G
  2.2        26        1408        R.IYECK.T
  2.2        26        1408        LYECK
  1.5        30        9.32        K.MANYAK.F
Top scoring peptide matches to query 338
Elution from: 30.37 to 34.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2948115.1 FinneganScanNumber: 1980
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.2       5.4        1422        K.IHSTVR.S
  9.2       5.4        1422        K.LHSLSR.S
  9.2       5.4        1422        R.LHSSLR.L
  9.2       5.5        1422        R.HLSSLR.Q
  9.2       5.5        1422        R.HLSTVR.T
  8.2       6.8        1406        M.AAARPAR.G
  6.6       9.9        1416        R.LFPAHK.Y
  4.5        16        1406        R.RPGVQR.V
  3.8        19        1422        -.XAPLGAAR.W
  3.2        22        1422        R.GVPANVR.V
Top scoring peptide matches to query 339
Elution from: 34.26 to 38.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 348079.8 FinneganScanNumber: 2339
Score greater than 24 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.7       1.7        1430        K.RKPPSK.M
 10.7       3.5        1399        RKPRR
 10.5       3.7        1430        R.GAPALKR.L
 10.4       3.7      -19.78        M.RKKPGK.G
 10.4       3.7       -4.04        K.VGKKGPK.H
 10.3       3.8        1430        K.RKSPPK.E
 10.0       4.1        11.7        R.LATPLAK.N
  8.8       5.4        1414        R.GVKRPR.E
  6.7       8.7        1430        K.GAPLAKR.S
  6.7       8.8        1399        KRPRR
Top scoring peptide matches to query 340
Elution from: 32.73 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 336723.6 FinneganScanNumber: 2192
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3       5.2      -14.09        M.VSMSFK.R
Top scoring peptide matches to query 341
Elution from: 29.34 to 33.32 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 517334.1 FinneganScanNumber: 1906
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.2       6.2        1417        R.GAPAGGAGR.A
  6.5        12        1417        R.AGPGGGAAR.G
  4.9        17      -15.26        R.GAPNISR.A
  4.8        17        1417        R.QPAQNR.E
  4.3        19      -15.26        R.AGPNSLR.F
  3.6        23        1417        R.SHSLNR.A
  2.8        27      -15.26        R.KPGEGAR.A
  1.7        35      -15.26        K.EPAGGRK.R
  1.6        36       -9.87        K.EPMLPK.E
  0.7        44      -15.26        R.QEGPRK.S
Top scoring peptide matches to query 342
Elution from: 32.93 to 36.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 102754.2 FinneganScanNumber: 2214
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.3       4.8        2.47        R.GLPAMPL.-
  5.3        15        1394        R.LGAPEAR.R
  3.5        23        1414        SSAHRR
  3.0        25        1414        R.HRSSAR.I
  3.0        25        1414        R.HSRSAR.S
  1.3        38        1413        MLFFR
  0.9        41        1403        K.HKLCR.R
  0.2        49       -8.57        K.HPVSFK.A
Top scoring peptide matches to query 343
Elution from: 30.40 to 34.39 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1004526.6 FinneganScanNumber: 1984
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8        11       -0.92        M.AAAAALAR.L
  6.1        17      -16.68        R.KSAPRR.N
  5.9        18        1396        K.QSLPLR.V
  5.2        21        1396        K.QSLIPR.T
  5.2        21        1396        K.SQLLPR.F
  5.2        21        1396        K.TNILPR.T
  4.4        25        14.8        R.SELPLR.G
  4.1        26        1396        K.LLGTPGR.A
  1.6        47      -16.71        R.GTKRPR.D
  1.5        48      -16.68        K.ASKRPR.S
Top scoring peptide matches to query 344
Elution from: 29.34 to 33.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 380099.8 FinneganScanNumber: 1907
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 345
Elution from: 21.03 to 25.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 429485.5 FinneganScanNumber: 1138
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 25.9      0.11        4.91        K.DSQNAGK.M
 16.3         1       -5.37        MAPEQK
 15.3       1.3       -5.39        -.MGSPSPK.T
 14.2       1.7      -16.35        R.GFAPDGR.R
 13.7       1.9        1401        K.MGNPQR.A
 13.1       2.2      -16.33        WQETR
 11.9       2.8       -5.37        R.MPSEAGK.R
 11.7         3       -0.68        R.WEAEGK.L
 11.6       3.1       -5.41        K.GVMDPGK.T
 11.4       3.2        4.89        R.GTGGGNXK.Q
Top scoring peptide matches to query 346
Elution from: 32.93 to 36.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 406896.9 FinneganScanNumber: 2213
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.1      0.86        1402        -.MPMPSR.D
 11.0         7        1387        K.SSGAGPSR.C
 10.0       8.8        1412        -.MSNPGGR.R
  8.9        11        1387        R.ASPSNSR.R
  8.8        12        1382        DLWER
  7.8        15        1403        R.EVEGER.R
  7.7        15        15.6        R.SASPDSR.K
  7.7        15        1387        R.GADVNSR.D
  7.7        15      -10.30        -.MAAPASR.Q
  7.7        15      -10.30        -.MAPAASR.L
Top scoring peptide matches to query 347
Elution from: 32.51 to 36.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47486219.6 FinneganScanNumber: 2175
Score greater than 20 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.1        26      -13.97        R.TTRVSR.E
  7.2        32        1.71        K.KISSER.R
  6.5        37        1.69        K.TLKDSR.S
  6.3        40        1408        R.TAGRASR.G
  6.1        41       -8.59        K.IAQLMK.D
  5.1        52        17.3        M.TEKVDK.R
  5.0        53        1389        R.TEIISR.S
  5.0        54        1408        R.SVRNSR.C
  4.4        62        1389        K.SITLER.G
  4.3        63       -8.59        R.LSKMKP.-
Top scoring peptide matches to query 348
Elution from: 32.43 to 36.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47486219.6 FinneganScanNumber: 2169
Score greater than 19 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.6        29        1379        K.ISICLL.-
  6.3        40       -8.59        K.IAQLMK.D
  6.0        43        1414        R.VPSLMR.L
  5.5        48        1414        -.MLLADR.C
  4.8        56        1.69        K.SSALVSR.S
  4.6        59        1.69        R.SIASSVR.R
  4.5        60        10.8        -.MSLRGR.F
  4.5        60        10.8        K.SMLRGR.G
  4.5        60        1.69        R.SLSVSAR.A
  4.1        66       -8.59        K.MSILQK.G
Top scoring peptide matches to query 349
Elution from: 35.67 to 39.67 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47486219.6 FinneganScanNumber: 2535
Score greater than 21 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.9        17        1389        K.LTSLER.L
  9.5        18        1389        R.TLTVER.L
  8.1        25        1409        R.SARTQR.L
  7.3        30        1409        TTGRQR
  6.9        33        1409        R.NSVRSR.M
  6.8        34        1393        SRGRSR
  6.7        35        2.00        R.SLTRKD.-
  6.3        38        1389        NLTSVGK
  6.3        39        1393        R.SGRRSR.G
  5.7        44        1383        K.MAGRKR.G
Top scoring peptide matches to query 350
Elution from: 35.65 to 39.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47486219.6 FinneganScanNumber: 2532
Score greater than 27 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.4       4.7        1389        R.TLTVER.L
 13.4       7.4      -19.24        R.FAPTKR.W
 12.4       9.4        1389        K.TKNVGSL.-
 11.3        12        1398        K.GNMLKR.Q
 11.1        13        1409        R.SARTQR.L
 10.4        15        1389        R.TLESLR.H
  9.0        21        1384        K.TYIPPK.G
  6.8        34        1389        K.SITLER.G
  5.0        51        1398        K.AACLKR.R
  4.9        53        1389        K.LTEISR.R
Top scoring peptide matches to query 351
Elution from: 33.75 to 37.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47486219.6 FinneganScanNumber: 2292
Score greater than 19 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.1        32        11.5        R.RMVAAR.T
  6.7        35        11.5        LMRQR
  5.8        44        1414        MGILER
  5.0        52       -7.88        K.IAQLMK.D
  4.4        59        1390        K.TKNVGSL.-
  3.8        68        1383        K.MAGRKR.G
  2.7        89        11.5        LMQRR
  2.7        89        11.5        R.LQMRR.F
  2.6        89        1414        R.MVALER.G
  2.1     1e+02        1414        -.MELGLR.W
Top scoring peptide matches to query 352
Elution from: 35.53 to 39.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12007972.5 FinneganScanNumber: 2508
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.8        41        1378        R.SKGMIPS.-
Top scoring peptide matches to query 353
Elution from: 41.11 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1622449.6 FinneganScanNumber: 3165
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 354
Elution from: 41.11 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1857511.8 FinneganScanNumber: 3166
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 355
Elution from: 34.26 to 38.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 137789.5 FinneganScanNumber: 2341
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.6        26       -5.89        K.ANTYVR.S
  4.5        33        1374        R.TYSVPR.L
  3.5        42        4.99        K.LQTSMK.N
  3.1        45        5.01        R.ALSASMK.W
  1.3        70        1374        R.FTEAVR.K
Top scoring peptide matches to query 356
Elution from: 35.09 to 39.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19209387.3 FinneganScanNumber: 2442
Score greater than 19 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5       6.4      -18.94        R.KHLVLN.-
  5.9       7.2        15.9        K.GHALAVR.K
  0.0        28       -3.38        K.YTIKAK.N
Top scoring peptide matches to query 357
Elution from: 35.04 to 39.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19209387.3 FinneganScanNumber: 2433
Score greater than 18 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.6       7.9      -18.94        R.KHLVLN.-
Top scoring peptide matches to query 358
Elution from: 34.98 to 38.96 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19202477.8 FinneganScanNumber: 2428
Score greater than 18 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8         3        15.9        K.GHALAVR.K
  5.4       8.3      -18.93        R.KHLVLN.-
  1.0        23        15.9        K.VRPSHK.R
Top scoring peptide matches to query 359
Elution from: 35.53 to 39.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9611029.5 FinneganScanNumber: 2508
Score greater than 15 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.7       1.9        16.6        R.TRPPPR.R
  1.4        21      -18.19        K.TKPHIK.E
Top scoring peptide matches to query 360
Elution from: 37.81 to 41.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4481161.6 FinneganScanNumber: 2898
Score greater than 16 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.6       2.1        17.4        R.LPKLPR.E
  0.4       2.2        17.4        R.LPPLRK.G
Top scoring peptide matches to query 361
Elution from: 37.85 to 41.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 217878.3 FinneganScanNumber: 2904
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 362
Elution from: 21.14 to 25.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1053052.0 FinneganScanNumber: 1149
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 363
Elution from: 24.51 to 28.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 661847.2 FinneganScanNumber: 1463
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.5         5        16.1        K.SPSLPPK.A
  8.2       6.8      -14.90        SPRIXR
  8.2       6.8      -14.90        R.SPRLPR.S
  7.2       8.3        0.58        R.VPSGLPR.R
  5.4        13      -14.90        M.PRSPLR.S
  5.2        13        1396        M.GPAARPR.R
  3.5        20        0.60        R.RLDPPK.V
  3.2        21      -14.90        R.RLPSPR.R
  3.0        22        1396        R.NHLGRK.L
  2.8        23      -14.90        R.RLPPSR.L
Top scoring peptide matches to query 364
Elution from: 34.31 to 38.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 237807.6 FinneganScanNumber: 2348
Score greater than 16 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 365
Elution from: 25.85 to 29.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2866850.1 FinneganScanNumber: 1596
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 366
Elution from: 40.82 to 44.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2085496.9 FinneganScanNumber: 3135
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 367
Elution from: 20.50 to 24.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 228760.7 FinneganScanNumber: 1092
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 368
Elution from: 34.65 to 38.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2867282.8 FinneganScanNumber: 2391
Score greater than 28 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.1         4        1372        R.VCAQVR.G
 15.8       4.3       -8.21        M.VLMQDK.G
 14.9       5.1        10.8        K.RPMSSR.G
 13.9       6.5        1363        R.EEVLSR.K
 13.8       6.7        1.90        K.VRSEDK.E
 11.8        11      -13.44        R.AGSKAGSR.A
 11.4        12       -3.63        M.VPFDQK.S
  9.8        17        1.90        K.SPSLSSR.A
  9.4        18        1382        K.QRADSR.E
  9.4        18        1382        K.QREGSR.A
Top scoring peptide matches to query 369
Elution from: 34.73 to 38.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 705484.3 FinneganScanNumber: 2404
Score greater than 27 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.3       2.6        1362        -.MIPASAK.A
 13.9       5.6        1387        K.AVVDSDK.K
 13.9       5.6        1387        R.GLVDSDK.G
 13.9       5.6        1387        K.ISSPSDK.K
 13.9       5.6        1387        K.SLPSSDK.R
 13.9       5.6        1367        K.VWVSDK.A
 11.4        10        1367        R.LWEASK.R
  8.7        18        7.63        K.NFSPAAK.R
  7.1        27        1367        R.WLEASK.A
  6.2        34        3.03        M.QQIMAK.K
Top scoring peptide matches to query 370
Elution from: 32.58 to 36.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11973044.1 FinneganScanNumber: 2181
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2        11        1381        K.ALKMTR.E
  3.3        35        1347        K.LLSMKK.V
  3.1        37        1381        -.MLTKAR.L
  3.0        37        1370        R.RLGSFR.F
  3.0        37        1370        K.RVASFR.S
  2.9        38        1370        R.GRLSFR.R
  2.9        38        1370        R.LRGSFR.C
  2.7        40        1381        K.MKTLAR.Q
  2.7        40        1370        R.SLGRFR.G
  1.5        53        1381        -.MSLTKR.V
Top scoring peptide matches to query 371
Elution from: 33.92 to 37.88 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7499204.9 FinneganScanNumber: 2301
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.7       3.2        1370        R.FGRTVR.A
  9.5       8.4        1381        -.MARLTK.R
  8.8       9.8        1347        R.SMKILK.R
  7.2        14        1347        K.TLKVMK.N
  6.6        16        1381        -.MSGGKKK.S
  6.5        17        1381        K.MSKNKK.K
  6.5        17        1386        R.FGGISVR.L
  6.5        17        1386        R.FNLSVR.Q
  6.4        17        1386        FVLSGGR
  5.1        23        1386        R.EVRFGK.R
Top scoring peptide matches to query 372
Elution from: 35.36 to 39.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22174326.1 FinneganScanNumber: 2484
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.8        16      -17.84        K.RAPPAPK.K
  2.4        36      -17.84        R.APPRPAK.T
  2.0        39        1366        K.VRFWK.C
  1.7        42        1356        R.VRPHAR.D
  0.5        57        1371        K.VGLGHPR.G
  0.0        62        1366        K.RVFWK.G
Top scoring peptide matches to query 373
Elution from: 32.73 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4742393.5 FinneganScanNumber: 2193
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.7       3.3        1355        K.KMSKVK.G
  7.5         7       -9.12        R.NHVLVR.I
  6.7       8.3       -9.12        K.NVHVLR.T
  6.3       9.1       -9.14        R.GHVVGLR.Y
  6.3       9.1       -9.14        R.HVGVAVR.D
  4.6        13       -9.10        K.GHIAALR.K
  3.6        17        1355        K.MKKSVK.A
  3.4        18        1384        -.MKKWK.S
  3.2        19        6.15        R.SSLFRK.I
  2.5        22        1384        MKWKK
Top scoring peptide matches to query 374
Elution from: 40.55 to 44.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 806357.8 FinneganScanNumber: 3118
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 375
Elution from: 35.20 to 39.17 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3721637.1 FinneganScanNumber: 2460
Score greater than 23 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.1       2.5        1378        R.SPPGLLR.A
  9.6       3.5        1378        R.SPGLPIR.S
  2.1        19      -18.91        K.KHSLKK.M
  1.8        21        1378        K.ELPKPR.H
  1.7        22        1363        K.HSKVLR.R
  1.5        22        15.1        R.ALGPARR.C
  1.2        24        1363        K.LVSKHR.A
  1.1        25        1378        R.LVHGSVK.H
  1.1        25        1378        -.XIHKDK.T
  1.1        25        1378        K.VLHKDK.S
Top scoring peptide matches to query 376
Elution from: 35.21 to 39.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3721637.1 FinneganScanNumber: 2461
Score greater than 25 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.8       1.3      -18.94        R.QKPVLR.S
 11.7       2.2        1378        K.IASLAHK.A
  9.9       3.3        1378        K.SAALLHK.E
  8.6       4.4        1378        R.LSLPGPR.L
  8.1       4.9        1363        R.SLVRHK.T
  8.1         5        1378        K.EKPLPR.L
  8.1         5        1378        K.GTVPLPR.S
  8.1         5        1363        M.RTPIPR.G
  8.1         5        1363        RTPLPR
  7.9       5.1        1378        R.SPGLPIR.S
Top scoring peptide matches to query 377
Elution from: 35.29 to 39.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3721637.1 FinneganScanNumber: 2474
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.0      0.25        1378        K.EKPLPR.L
 21.0      0.25        1378        K.GTVPLPR.S
 21.0      0.25        1363        M.RTPIPR.G
 21.0      0.25        1363        RTPLPR
 15.4      0.92      -18.94        R.GKPALVR.R
 13.0       1.6      -18.94        R.QKPVLR.S
 12.4       1.8        1378        K.KELPPR.E
 11.8       2.1        1363        K.TRIPPR.T
 11.8       2.1        1363        R.TRLPPR.L
  9.3       3.8        1378        R.SPGLPIR.S
Top scoring peptide matches to query 378
Elution from: 34.09 to 38.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1253166.7 FinneganScanNumber: 2317
Score greater than 24 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.9       1.9        1368        K.MYGTLR.K
 10.9       3.8        1353        -.MPVTHR.K
  7.8       7.9        1359        R.SSLSSFL.-
  7.2       9.1       -1.74        K.KEAEHK.R
  6.6        10        1368        -.MFSAIR.S
  6.5        11        1348        K.GHTGRGR.R
  6.5        11        1348        R.AGSHGRR.S
  5.7        13        1363        R.KEHGNR.S
  5.3        14        1368        R.YMGTLR.G
  5.1        15        1353        -.XPHSLR.Y
Top scoring peptide matches to query 379
Elution from: 34.09 to 38.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1253166.7 FinneganScanNumber: 2320
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.9       7.7      -16.93        R.RETHAK.I
  6.8        10       -1.76        K.EPKPDR.L
  6.0        12        1368        -.MASLFR.S
  5.5        13        1353        -.MPVTHR.K
  5.3        14       -1.78        R.QQPPSGK.R
  5.3        14        1368        -.MSFLSR.Q
  4.2        18        1368        -.MAFLSR.T
  4.2        18       -1.76        R.NHTLEK.I
  4.1        18        1358        K.LHWER.A
  4.0        19        1353        R.HLPSMR.Y
Top scoring peptide matches to query 380
Elution from: 35.32 to 39.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 414874.3 FinneganScanNumber: 2475
Score greater than 34 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.3       1.1        1335        R.AWVGRR.A
 20.1       1.8        1340        R.AREGRR.H
 20.1       1.8        1340        R.ERAGRR.G
 20.1       1.8        1356        R.GADLGRR.E
 20.1       1.8        1356        K.GLEGGRR.S
 20.1       1.8        1356        K.LDQGRR.A
 20.1       1.8        1356        R.NLEGRR.K
 20.1       1.8        1356        R.QVEGRR.G
 20.1       1.8        1340        R.RAEGRR.E
 20.1       1.8        1340        R.REAGRR.T
Top scoring peptide matches to query 381
Elution from: 35.21 to 39.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 414874.3 FinneganScanNumber: 2462
Score greater than 28 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.5       5.3        1350        K.WIGVNR.R
 14.2       7.1        1356        R.RAEAAAR.S
 14.2       7.2        1337        R.LLEDVR.L
 12.9       9.5      -16.72        K.KVQRGSA.-
 12.0        12        1356        R.LDQRGR.V
 11.3        14        1356        K.ELGGRGR.K
 11.3        14        1341        R.ERARGR.G
 10.9        15        7.14        -.MVSRPR.S
  9.8        20       -1.63        K.GTLAEVR.A
  9.7        20        1356        R.DLQRGR.V
Top scoring peptide matches to query 382
Elution from: 35.43 to 39.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3679506.1 FinneganScanNumber: 2498
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.9        21        1337        K.TGSSGPLQ.-
  5.1        25        1337        K.TSEPQGK.V
  4.6        28        0.83        R.KHMMGK.R
  3.2        38      -13.05        R.TAAQNSR.L
  2.7        43        1332        R.YTTFSK.R
  1.2        60       -3.42        K.TDTWPK.D
  1.1        61        2.00        M.SEADGLR.Q
  1.0        62        1366        K.FSSYSR.R
Top scoring peptide matches to query 383
Elution from: 35.41 to 39.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3679506.1 FinneganScanNumber: 2492
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.7        27        17.0        R.LGNEVTD.-
  4.6        27        1337        K.NAEPTSK.G
  4.1        31        2.00        K.AEQTGNK.R
  4.1        31       -4.31        R.QGCRAR.L
  4.0        31        1361        CSPASPK
  2.9        41      -18.44        K.WKDGNK.F
  2.7        43        2.00        R.EGLDSAR.A
  2.4        46        1332        R.EPTTWI.-
Top scoring peptide matches to query 384
Elution from: 35.86 to 39.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2759734.3 FinneganScanNumber: 2568
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.2         5        1339        K.SSLASQR.S
  9.5        15        1329        R.MELAIR.N
  9.5        15        1329        -.MELALR.R
  8.7        18        1.79        K.YNPSLR.S
  7.9        22        1354        R.SISANEK.K
  7.9        22        1354        R.ISSAENK.S
  7.7        23       -2.71        R.AQQMKK.D
  6.4        30        1329        R.EMALLR.G
  6.3        31        1324        R.SSRVSGR.H
  6.3        31       -2.73        K.SLTCLR.V
Top scoring peptide matches to query 385
Elution from: 34.85 to 38.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1152021.9 FinneganScanNumber: 2413
Score greater than 29 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.8       2.3        1360        K.YAGVSPR.D
 15.6       3.1        1332        K.QKSATSK.R
 11.8       7.4        1322        K.LASIMSK.L
 11.5       7.9        1345        R.FSRSPR.L
 11.5         8        16.9        R.LSASASSK.E
 10.6       9.7        5.20        K.HLMPPR.T
 10.2        11        1360        K.YEGPRK.A
  9.7        12        1332        K.GKKSDSK.R
  8.4        16        1360        R.EPPGPPR.A
  8.1        17        0.07        K.RGGRAPH.-
Top scoring peptide matches to query 386
Elution from: 34.65 to 38.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1152021.9 FinneganScanNumber: 2392
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.6       4.9      -18.50        K.HLDPIR.E
 11.4       8.1        0.09        R.HAPNRR.S
 10.0        11       -3.52        K.DFILSR.G
 10.0        11       -3.52        K.DFLLSR.K
 10.0        11       -3.52        K.DILFSR.E
  8.9        14        15.7        -.MLSMLR.T
  8.6        15        1340        -.MASLRR.V
  8.3        17        1360        R.EPPGPPR.A
  8.1        17       -3.52        FLSDLR
  8.1        17       -3.52        K.LFSDLR.E
Top scoring peptide matches to query 387
Elution from: 33.92 to 37.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1214749.0 FinneganScanNumber: 2302
Score greater than 22 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       2.5       -4.28        R.LAPLPSR.R
  9.3       4.3      -19.22        R.LRTHVK.G
  9.3       4.4        1354        R.LAAAPGPR.R
  9.0       4.6       -4.28        K.ALPLSPR.K
  7.6       6.4      -19.22        R.HLVTKR.L
  6.6       8.1        1339        R.LAKHQR.Y
  6.6       8.1        1339        R.LAQHRK.V
  5.9       9.4        1339        R.GIRGPPR.Q
  5.9       9.4        1354        K.APAPQIR.K
  5.3        11       -4.28        R.LASPLPR.E
Top scoring peptide matches to query 388
Elution from: 38.10 to 42.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 375754.2 FinneganScanNumber: 2940
Score greater than 14 indicates homology
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.9        11      -11.63        K.IKHTKK.S
  1.9        11        1344        R.KIHTRV.-
  1.9        11        1344        K.LKHTVR.S
Top scoring peptide matches to query 389
Elution from: 35.29 to 39.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 252736.8 FinneganScanNumber: 2472
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.1        12       -3.53        R.LSVAVLR.E
  8.1        12       -3.53        K.VSIAVLR.G
  8.0        12       -3.53        R.LAVSVLR.E
  7.0        16        14.9        R.AAVKRGR.S
  6.5        18      -18.38        R.TLRIVR.E
  6.5        18      -18.38        R.TLRVLR.M
  6.5        18       -3.55        R.TLVGLVR.D
  6.5        18       -3.53        R.GLLIVSR.E
  1.9        50       -3.51        K.ATLALLR.S
  1.9        51        1314        K.IKSIPAK.G
Top scoring peptide matches to query 390
Elution from: 23.89 to 27.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 761675.1 FinneganScanNumber: 1389
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.9      0.44       -0.33        K.IIDKLR.F
 21.9      0.44       -0.33        K.ILDKLR.H
 21.6      0.47       -0.33        R.LKVEIR.L
 21.6      0.47       -0.33        K.LKVELR.S
 20.2      0.64        1317        K.ILLLER.A
 20.2      0.64        1317        K.LLIAAQK.Q
 20.2      0.64        1317        R.LLLLER.T
 19.6      0.75        1317        K.ILEIIR.V
 19.6      0.75        1317        K.ILELLR.H
 19.6      0.75        1317        R.LIELIR.S
Top scoring peptide matches to query 391
Elution from: 34.09 to 38.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 397515.6 FinneganScanNumber: 2319
Score greater than 21 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.5       9.6        1314        R.SLLGDPR.L
  9.2        10      -16.15        -.GGGKAAAAR.S
  7.6        15        1314        R.GLGQGTPK.G
  6.7        18       -1.32        R.NGEALVR.F
  6.5        19      -16.15        R.AVEGARR.A
  5.3        25       -1.32        K.AIDGLNR.N
  4.6        30      -16.17        R.QNGGKVR.H
  4.5        31      -16.15        K.RLAADGR.G
  2.8        45        1338        R.MASPPVR.G
  1.9        56        1342        R.LAWDPR.K
Top scoring peptide matches to query 392
Elution from: 34.09 to 38.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 453552.6 FinneganScanNumber: 2321
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.6       9.1        1316        -.MGRGGER.K
 10.3       9.7        1331        -.XTGGPGSR.A
 10.1        10        1298        -.MSPGSGVK.S
  8.3        15        1331        K.DGGMVQR.F
  7.9        17        1298        R.MLDDIR.S
  7.9        17        1298        -.MVEEVR.H
  7.9        17        1331        R.CAQVER.A
  7.3        19        1316        -.MGRDQR.A
  6.2        25        1308        R.EAQSTAR.E
  5.9        27        18.7        -.MPWSSR.G
Top scoring peptide matches to query 393
Elution from: 33.71 to 37.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 54533554.8 FinneganScanNumber: 2288
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.1        12        1327        ERKSSR
  6.7        26        1318        -.MSLQKR.V
  6.0        30        1327        K.RESKSR.S
  6.0        30        1318        K.MAKIQR.T
  6.0        30        1318        R.MSQIKR.L
  5.2        37        1318        R.AIGKMAR.V
  4.6        42        1318        K.KAGALMR.K
  4.6        42        1318        K.QAKIMR.K
  4.2        46        1336        RQRMR
  3.3        56        1318        M.QIKAMR.R
Top scoring peptide matches to query 394
Elution from: 33.55 to 37.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 54533554.8 FinneganScanNumber: 2278
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        27        19.9        K.WVLAMK.R
  5.6        33       -3.44        R.LLDGAFK.L
  4.4        44        1332        -.MATPSKK.T
  2.6        66        1318        -.MAKSGLR.Q
  2.4        69        10.4        R.GMKGKAR.K
  0.6     1e+02        1322        K.ILHDHK.I
  0.5   1.1e+02       -3.46        R.VYTPVGK.A
  0.1   1.2e+02        10.4        K.RKNSMK.V
  0.0   1.2e+02        1318        -.MSLQKR.V
  0.0   1.2e+02        1318        R.MSQIKR.L
Top scoring peptide matches to query 395
Elution from: 33.60 to 37.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 54533554.8 FinneganScanNumber: 2281
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.1         6        1318        R.MSQIKR.L
  9.4        14        1322        R.AFQLQR.R
  8.3        18        1318        K.MAKIQR.T
  7.6        21        1318        K.AMAKGLR.G
  7.0        24        1318        -.MSQIRK.L
  6.7        26        1318        -.MSLQKR.V
  6.3        28        1327        ERKSSR
  6.3        28        1327        K.RESKSR.S
  5.7        32        1318        -.MAAGLRK.R
  5.4        34        1318        M.KCLVSR.H
Top scoring peptide matches to query 396
Elution from: 34.86 to 38.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 55276089.0 FinneganScanNumber: 2417
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.7       6.3        1318        R.MSQIKR.L
 11.6       8.1        1318        -.MSLQKR.V
  9.9        12        1318        -.MQLSKR.E
  9.8        13        1322        K.SSWVKR.H
  6.7        26        1303        R.MKTRAR.W
  6.5        27        1327        R.SSERKR.H
  6.0        30        1318        K.AVAMSKR.Y
  4.9        38        1318        K.EKAMKR.R
  4.2        45        1322        R.AFQLQR.R
  4.2        45        1318        K.MAKIQR.T
Top scoring peptide matches to query 397
Elution from: 36.62 to 40.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 54456146.3 FinneganScanNumber: 2697
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.7       5.1        1318        K.AMAKGLR.G
 13.5       5.3        1313        K.RRSTSR.Q
 12.9       6.1        1328        K.RESKSR.S
 12.8       6.3        1328        K.RXSDTR.K
 11.6       8.2        1308        R.LHLSHR.V
 11.2       8.9        11.0        K.RMTISR.L
 10.5        11        1322        R.VGFVGAGR.M
  9.7        13        1333        K.NSAVMLK.Q
  9.2        14        1308        R.RNFGIR.K
  8.0        19        1308        K.RFGNLR.N
Top scoring peptide matches to query 398
Elution from: 35.45 to 39.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 688196.2 FinneganScanNumber: 2500
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.7        17        1306        K.ISEIMR.S
  5.7        27        1334        R.FSMVHK.R
  5.5        28        6.80        K.DFERAK.A
  5.3        29        1321        R.IDIMEK.D
  5.3        29        1306        R.LVETMR.F
  4.5        36        1324        R.QRAMSR.A
  4.5        36       -7.29        K.AVAMVMK.E
  4.3        37        17.1        K.TSALMDK.F
  4.2        38       -7.29        K.AVAMVMK.E
  3.9        40        2.39        K.DSMIRK.F
Top scoring peptide matches to query 399
Elution from: 35.86 to 39.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18208722.2 FinneganScanNumber: 2569
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 400
Elution from: 35.75 to 39.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18208722.2 FinneganScanNumber: 2549
Score greater than 14 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.6        16        1315        K.LPPGAGVR.E
  1.6        32        1301        R.LQPRPR.K
  1.6        32        1301        K.ALGPRPR.G
  1.4        34        15.2        R.HTQILR.R
Top scoring peptide matches to query 401
Elution from: 35.77 to 39.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18208722.2 FinneganScanNumber: 2552
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.6       8.1        1315        K.LPPGAGVR.E
  7.1       8.9        1301        R.APPRGXR.X
  7.1       8.9        1301        R.APPRGXR.X
  5.5        13        15.2        K.KHDLVR.R
  3.5        21        15.1        K.GHLSVVR.S
  2.1        29        1330        R.DFKKTK.T
  1.7        31        15.2        R.HKDIVR.L
Top scoring peptide matches to query 402
Elution from: 35.70 to 39.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18208722.2 FinneganScanNumber: 2541
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.1        14        1315        R.TPAPPRK.G
  4.1        18      -17.63        R.LKELHK.T
  3.7        20        1301        K.ALGPRPR.G
  3.7        20        15.2        R.LEPRRP.-
  3.6        20        1301        R.AIRPGPR.Q
  0.2        44        1315        M.AVAVPPGR.A
Top scoring peptide matches to query 403
Elution from: 19.49 to 23.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4530520.8 FinneganScanNumber: 1026
Score greater than 19 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.3       3.1        3.23        R.VLLKPAK.F
Top scoring peptide matches to query 404
Elution from: 20.74 to 24.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6361773.0 FinneganScanNumber: 1115
Score greater than 19 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 405
Elution from: 19.56 to 23.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1763061.0 FinneganScanNumber: 1030
Score greater than 15 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.2       6.4       -1.77        R.VLRLIR.G
  2.2       6.4       -1.77        VLRLLR
  2.2       6.4       -1.77        R.VRLLLR.G
Top scoring peptide matches to query 406
Elution from: 35.57 to 39.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2750077.7 FinneganScanNumber: 2516
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.1       5.6        5.22        -.MHFAKK.H
 11.9       9.2        1308        M.SMLGPQK.R
 11.7       9.7        19.7        -.MSPIWK.Q
 11.1        11        1308        K.MPNSLSK.Q
 10.6        12        16.5        R.LETAESK.E
  9.7        15        1308        -.MVSSQPK.Y
  9.6        16        16.5        R.ETLEASK.Q
  9.1        18       -7.52        K.GLLSEMK.K
  8.0        23        1279        -.MAAATRR.V
  7.8        24        1289        -.MKPAWK.D
Top scoring peptide matches to query 407
Elution from: 35.55 to 39.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2750077.7 FinneganScanNumber: 2514
Score greater than 28 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.0       0.9       -7.52        K.GLLSEMK.K
 14.4       5.1       -7.50        K.LKEEMK.S
 13.0       7.2        1286        K.KLEDGSK.F
 11.8       9.4        1308        -.MVSSQPK.Y
 11.6       9.8        19.7        R.WPSLMK.H
 11.2        11        14.7        R.SSYRHK.G
 10.9        12       -7.50        K.EELKMK.I
 10.9        12        5.22        K.HSFKMK.D
 10.9        12       -7.52        R.ISVAEMK.S
 10.9        12       -7.50        K.LEEKMK.A
Top scoring peptide matches to query 408
Elution from: 34.88 to 38.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12580196.6 FinneganScanNumber: 2420
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.9        32      -18.22        K.GVIHGLGK.V
  2.9        32        4.61        -.MKFRAK.I
  2.8        32        14.1        R.ARSPPPR.S
  2.7        33       -0.32        K.HSPKRR.L
  2.4        36        1275        R.FTAISIK.I
  2.4        36        14.1        -.PRPASPR.T
  2.3        36      -18.20        R.LGAPAVPR.R
  2.3        36      -18.20        R.LQPLGPR.A
  2.2        37        14.1        K.RPSPAPR.T
  2.1        38        14.1        R.SPHKVGR.R
Top scoring peptide matches to query 409
Elution from: 33.73 to 37.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 14370127.6 FinneganScanNumber: 2291
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.9       1.6        1293        K.RTLSFR.K
 14.9         2        1307        K.LSFKER.V
 14.8         2        1293        K.RVTFTR.A
 14.4       2.2        1307        K.AEYLKR.Y
 13.5       2.8        1307        K.IYEAKR.F
 13.4       2.8        1293        K.RFSITR.S
 13.4       2.8        1307        R.LSLYQR.A
 13.0       3.1        1293        R.YLRTAR.K
 12.8       3.3        1307        R.SSVFALR.A
 12.8       3.3        1307        R.YILTNR.G
Top scoring peptide matches to query 410
Elution from: 35.55 to 39.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1452857.4 FinneganScanNumber: 2515
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.2       2.5        19.3        R.RQSMLF.-
  8.5        12        1287        R.RKSMSR.W
  7.5        15        4.87        R.RAMRTF.-
  7.0        16        19.3        K.RSMPFK.K
  6.2        20      -17.89        K.ASPHGGKK.A
  6.2        20       -3.48        K.YDKSLR.K
  2.7        44        15.0        -.MMKSLR.V
  2.7        44        15.0        -.MMKSLR.V
  2.5        46        1277        K.RAMKMK.M
  2.5        47        1292        M.IMNKMK.N
Top scoring peptide matches to query 411
Elution from: 35.88 to 39.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4142019.5 FinneganScanNumber: 2571
Score greater than 22 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.1      0.93        1272        R.KRVPQR.G
  8.8         5      -17.76        R.ANVVLLR.Y
  8.8         5      -17.76        K.NAVVILR.Y
  7.4       6.9       -3.40        R.LPAKKID.-
  4.8        13        9.20        K.HIFVLR.E
  4.8        13        9.20        K.LHLFVR.A
  4.7        13      -17.74        K.AALAGLLR.L
  4.7        13        1272        K.GRGLKPR.R
  4.7        13        14.4        K.RDLPKR.T
  4.7        13        1272        R.VRKAGPR.D
Top scoring peptide matches to query 412
Elution from: 35.82 to 39.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4142019.5 FinneganScanNumber: 2561
Score greater than 22 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.8      0.64       -3.40        R.LPAKKID.-
  9.0       4.8       -3.40        K.LAPKDIK.I
  5.9       9.7       -3.42        K.LPVTINK.F
  4.1        15        14.4        K.GKQAPRK.K
  2.5        22        14.4        K.KQQPRK.A
  2.4        22        1272        R.KRVPQR.G
  2.4        22        14.4        R.LRDPRK.K
  2.4        22        14.4        K.RDLPKR.T
  2.2        23       -3.42        R.LVSAPLGK.F
  2.2        23        1301        R.TTVPLPR.E
Top scoring peptide matches to query 413
Elution from: 35.75 to 39.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4142019.5 FinneganScanNumber: 2551
Score greater than 25 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.7      0.65       -3.40        K.LAPKDIK.I
 11.0         3        1301        K.NPSKPIK.A
 10.4       3.5       -3.40        R.LPAKKID.-
 10.2       3.6        1286        K.SHGKKVK.R
  8.0         6      -17.74        K.QIALALR.H
  7.0       7.5      -17.74        R.LAGALALR.A
  7.0       7.6        1268        R.VPDVLIK.K
  6.5       8.5       -3.40        R.LAPDKLK.S
  6.2         9       -3.42        K.LPVTINK.F
  4.9        12        14.3        R.SLPGVRR.T
Top scoring peptide matches to query 414
Elution from: 34.86 to 38.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2215760.2 FinneganScanNumber: 2418
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.8      0.33        1278        K.MELHVR.W
 18.8      0.65        1273        R.SSAAHRR.E
 17.9       0.8        1296        K.IFEGYR.S
 17.1      0.95        1278        LMEHVR
 14.7       1.7       -1.13        K.LAEPAER.Y
 12.6       2.7        1287        R.SDAAKHR.R
 11.4       3.5        1282        R.FPEHVR.E
 11.0       3.9      -15.48        K.SSHLVSR.T
 11.0       3.9      -15.48        K.SSSVIHR.T
 10.2       4.7        1296        IFSDFR
Top scoring peptide matches to query 415
Elution from: 20.08 to 24.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 473384.1 FinneganScanNumber: 1060
Score greater than 33 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.6       1.1        1269        R.GAAGTRVR.S
 19.2       1.9        1269        K.KAGGGGGKR.K
 19.0         2        1283        R.QAGGSLVR.N
 17.3         3       -0.14        M.NEVSVIK.E
 16.9       3.3      -14.40        R.LSKDIGR.L
 14.5       5.8        8.17        -.MKREPK.N
 13.8       6.8      -14.39        R.QAEGKKK.L
 13.6         7        1283        R.QKAGEVR.S
 13.6       7.1        1265        K.LEDLGLK.Q
 13.1       7.9       -0.12        ELANTIK
Top scoring peptide matches to query 416
Elution from: 35.90 to 39.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 638271.1 FinneganScanNumber: 2573
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.5       3.3        1273        -.XAVMAPR.T
 11.1        11        1282        K.EAVSARR.A
 10.3        14        1282        R.ERVASAR.E
  9.8        16        1264        K.EALVSAAK.L
  9.1        18      -13.88        R.SSLAGRAK.L
  7.3        27        1282        K.GARTDLR.N
  7.3        28        1268        R.KTRNGGR.E
  7.2        28        1282        R.RQTVER.R
  5.4        42      -19.01        R.LWLTXR.K
  5.0        46        1268        M.EATRRR.Q
Top scoring peptide matches to query 417
Elution from: 35.25 to 39.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4708910.9 FinneganScanNumber: 2468
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.2         7      -12.76        R.SSEGRQK.A
  9.1        11        1262        K.ETVAAAQT.-
  9.0        12      -17.86        R.WSSGLNK.H
  8.3        14        1.43        K.GDTSGNLK.K
  8.3        14      -12.76        K.EGRSTNK.E
  8.1        14        1.44        R.STENVNK.L
  8.1        14        1.44        K.TSNDINK.E
  7.8        16        1275        K.STHFNGK.S
  7.4        17        1256        R.GMKNGAGR.F
  7.4        17        1.43        K.SSVDQAGK.Y
Top scoring peptide matches to query 418
Elution from: 36.15 to 40.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3576372.4 FinneganScanNumber: 2617
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.9       1.5        1257        -.MSQRPR.A
 11.7       6.3        1271        R.MVPSNAR.F
  8.6        13        1263        R.LGEQESK.Q
  7.6        16      -11.93        R.RQSEGSK.G
  6.3        22        1263        K.EDQALSK.E
  6.3        22        1263        R.GEDALASK.G
  6.2        22       -7.07        -.MIPSEAK.E
  6.0        23        1271        R.MENPRK.W
  6.0        24        16.5        K.EENLISS.-
  4.8        31        1286        MEAPAQK
Top scoring peptide matches to query 419
Elution from: 36.31 to 40.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3576372.4 FinneganScanNumber: 2643
Score greater than 23 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.0       4.6        1.18        -.MMTKHK.K
 12.9       4.8       -7.07        R.EAPLMSK.T
  9.8       9.9      -17.03        R.SPHPPEK.C
  9.5        11        16.5        K.ALEDSEK.A
  8.9        12        1266        K.FMDLHK.E
  8.3        14        1.18        -.MMTKHK.K
  8.1        14        1263        M.AQDLSEK.D
  6.6        20        16.5        K.EEDVATK.R
  6.3        22       -7.07        K.ALSMPEK.W
  6.2        22        2.28        K.AEATNTGK.Y
Top scoring peptide matches to query 420
Elution from: 20.55 to 24.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 264051.6 FinneganScanNumber: 1098
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.4       2.9        14.1        K.SXDSFLK.R
 13.8       5.2        14.2        K.FEEIQK.R
 13.8       5.2        14.2        FEELQK
 13.8       5.2        9.93        R.MEEKIK.N
 13.8       5.2        9.93        MEEKLK
 13.8       5.2        9.93        K.MEELKK.Y
 13.2         6       -4.28        -.MTASVLR.S
 11.6       8.6        1263        R.LTASSASR.V
 11.6       8.7        17.5        R.HSHSGLR.A
 11.4       8.9        3.37        R.NRGPHGR.S
Top scoring peptide matches to query 421
Elution from: 35.61 to 39.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1555827.3 FinneganScanNumber: 2523
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.8       1.5        1276        R.FPVATMK.T
 14.6       3.1        1281        R.NGKISMK.D
 13.0       4.5      -16.48        K.GRSLSFK.T
 12.8       4.7        1254        K.IGELFSK.F
 11.8         6        1258        K.MQKKMK.K
 11.3       6.7      -16.48        K.GRSSIFK.V
 11.2       6.9        1254        K.VTVYPSK.T
 10.9       7.2        1285        K.FQNAVSK.Y
 10.9       7.3        1258        K.KQMKMK.Q
 10.8       7.4        1281        K.TLERMK.K
Top scoring peptide matches to query 422
Elution from: 35.53 to 39.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1555827.3 FinneganScanNumber: 2510
Score greater than 29 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.4       1.3        1254        R.IGTFDLK.Y
 15.5       2.5       -2.31        K.NSIVAYK.A
 12.1       5.5        1257        -.XGPRPPR.V
 11.8       5.9        1254        R.SSIPVYK.K
 11.5       6.3        1254        K.LFVETGK.A
 11.3       6.6        1272        R.IMIICK.A
 10.8       7.5        1281        K.IMKNSGK.T
 10.7       7.7        1276        R.FPVATMK.T
 10.2       8.7        1271        K.SHAHTIK.L
  9.7       9.6        1267        R.MGGKRTK.K
Top scoring peptide matches to query 423
Elution from: 23.79 to 27.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 570557.6 FinneganScanNumber: 1383
Score greater than 29 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 17.6       1.4       -0.27    1   IPI00301263 R.LYELTR.I
 17.6       1.4        13.9                    R.LYLEEK.H
 15.1       2.4        13.9                    K.LIYEEK.L
 14.7       2.6        1256                    K.FKELEK.I
 14.7       2.6        1256                    R.FKLEEK.V
 14.7       2.6        1283                    K.KMNKEK.T
 13.5       3.5        1256                    K.EFLKEK.E
 13.5       3.5        1256                    R.FELEKK.A
 13.5       3.5        1256                    R.LYIEQK.T
 13.5       3.5        1256                    YLLEQK
Top scoring peptide matches to query 424
Elution from: 36.83 to 40.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 794661.9 FinneganScanNumber: 2733
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.3       6.1      -17.64        R.YISGTVR.G
 10.7         7        1283        YEDLVR
  8.9        11        1268        R.YEAQKR.I
  8.9        11        1268        -.XEAQRK.L
  8.9        11      -17.60        R.YKSELR.K
  8.8        11        1268        R.YQAAVSR.G
  8.3        12        1268        R.APGDAVHK.I
  7.7        14        1278        R.MKSGLDK.L
  7.4        15        1264        -.MKLGSSR.A
  7.2        16        1283        R.NLGLYGSA.-
Top scoring peptide matches to query 425
Elution from: 34.55 to 38.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1112732.5 FinneganScanNumber: 2381
Score greater than 22 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.3       2.6        13.8        -.QGPLGAVR.K
  9.2       4.2        1251        R.APSPRLR.S
  9.1       4.3        1265        K.KKPHLSS.-
  8.0       5.6      -17.75        R.APEVLLR.S
  8.0       5.6        1265        R.RTPPPTK.R
  4.0        14      -17.75        R.APEILVR.L
  3.2        17        13.8        -.LAITSHR.V
  0.5        32        1279        K.DPAPKLVG.-
  0.5        32       -0.27        -.XQPAGLR.L
  0.4        32       -0.27        K.GAQPLRR.S
Top scoring peptide matches to query 426
Elution from: 35.02 to 39.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 959463.6 FinneganScanNumber: 2432
Score greater than 23 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.3       1.5        1259        K.KRFAFK.T
 12.8       1.8        1264        R.QKQKHK.D
  9.2         4        1264        R.KDHLRK.H
  8.2       5.1      -18.68        K.KGKSLHK.D
  7.3       6.2        1278        K.EIAAKHK.K
  7.2       6.3        1278        K.KEAAHIK.A
  7.2       6.3       -4.56        K.KEAPKPK.V
  7.2       6.3        1264        R.KEHVRK.T
  7.1       6.5        12.9        R.QRRIPQ.-
  7.1       6.5      -18.68        R.GNLPLRK.L
Top scoring peptide matches to query 427
Elution from: 35.50 to 39.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1171147.1 FinneganScanNumber: 2506
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 31.2     0.034        1268   30   IPI00296259 M.AGVGAGPLR.A
 27.2     0.084        1254                    R.RAGGPLAR.G
 18.0      0.71      -13.16                    R.TPALGLAR.L
 16.7      0.96        18.4                    R.GARPELR.S
 16.1       1.1        18.4                    K.RGIPEAR.E
 13.4         2        1254                    R.RGLAGPAR.R
 12.8       2.3        1254                    M.RAPAQVR.T
 12.7       2.4        1277                    K.IDKFFK.Q
 12.6       2.5        1254                    R.RALAPNR.H
 12.5       2.5        18.4                    R.KVSAHTR.A
Top scoring peptide matches to query 428
Elution from: 35.57 to 39.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1171147.1 FinneganScanNumber: 2517
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 15.8       1.2        1268   30   IPI00296259 M.AGVGAGPLR.A
  7.7       7.6        1254                    GTAHRKK
  7.5       7.9        1277                    K.IDKFFK.Q
  5.5        13        1254                    R.RAGGPLAR.G
  5.4        13        1268                    R.GAGVAPGLR.W
  5.2        13        1254                    R.TKRHQK.F
  5.2        13        1254                    R.TQHRKK.C
  5.0        14        1268                    K.ASHNLKK.K
  4.9        14        18.4                    K.TGHRLSK.T
  3.5        20        1268                    R.QGGLGPIR.I
Top scoring peptide matches to query 429
Elution from: 35.93 to 39.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 305937.8 FinneganScanNumber: 2577
Score greater than 31 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.2      0.48        14.4        R.RAKITGR.E
 17.1       1.6        1259        K.REVLKR.R
 14.8       2.6       -3.03        K.KAAVVVSK.S
 14.4       2.9        1259        R.REVRIK.K
 13.0         4        1273        K.TALAVAVR.S
 12.7       4.3        1259        R.RERVLK.L
 12.3       4.8        1259        K.RELVRK.I
 12.0         5      -17.04        K.KASLKVR.D
 11.8       5.3        1259        R.RLLGVSR.L
 11.2       6.1        1273        K.VLGKEVR.D
Top scoring peptide matches to query 430
Elution from: 28.91 to 32.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 352269.9 FinneganScanNumber: 1859
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 27.4      0.31      -18.49        -.MAAAATLR.L
 23.6      0.75        4.64        R.VGGTGGAASK.L
 19.3         2      -18.49        K.MAAVEKR.R
 19.2       2.1      -18.51        K.MALSGGLR.C
 18.1       2.6        1231        K.KTGNQQK.V
 17.9       2.8        1245        R.LTGELDR.E
 17.8       2.8        4.66        K.VTSEVNR.L
 17.6       2.9        1231        M.AASGLGATR.A
 17.0       3.4      -18.51        R.CKILDR.H
 16.1       4.2        1253        R.MGLAGAAGR.W
Top scoring peptide matches to query 431
Elution from: 37.58 to 41.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47009221.3 FinneganScanNumber: 2862
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.9        20        1236        R.FAKERR.L
  6.9        20        1263        -.MSTRRR.H
  5.4        28        8.81        K.WTVFVR.A
  5.1        30        1231        K.KISRMR.L
  4.9        31        18.8        K.SSRSSKR.G
  4.7        33        1250        K.NFIKER.S
  4.6        34        1236        K.QISRFR.R
  4.4        35      -17.37        R.TLYVGVR.M
  4.3        36        1245        R.KDLMKR.T
  4.3        36        1263        K.AFKESPK.Q
Top scoring peptide matches to query 432
Elution from: 34.55 to 38.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47009221.3 FinneganScanNumber: 2379
Score greater than 29 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.5       1.7        1231        R.RTVKMR.K
 15.5       2.8        1259        K.MKSKEAL.-
 14.7       3.3        1245        R.KDLMKR.T
 11.4       7.1        1231        K.LSRKMR.K
  6.6        21        1231        K.RTKMVR.T
  6.4        22        1245        R.VKEMKR.M
  6.3        23        9.68        K.RKTMSGK.E
  6.0        24        1255        K.RGSSKSGK.L
  5.7        26        1259        R.SMQKLSL.-
  4.8        32        1263        R.VDQIFGK.A
Top scoring peptide matches to query 433
Elution from: 37.68 to 41.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 35803941.6 FinneganScanNumber: 2877
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.7        13        1245        -.MKLSGVR.R
  8.6        13        1263        MSRRTR
  8.6        13        1263        -.MSTRRR.H
  7.4        17        4.71        R.FAAVIMR.I
  5.5        27        13.9        K.YQKVRN.-
  5.3        28        4.71        -.MAFLAVR.F
  5.3        29        1259        R.KSSMPIK.I
  5.1        30        1231        K.RTKMVR.T
  5.0        31        1231        K.LSRKMR.K
  4.6        34        13.9        K.FDKKGGR.-
Top scoring peptide matches to query 434
Elution from: 34.67 to 38.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47009221.3 FinneganScanNumber: 2394
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.0        31        1236        K.GRFAISR.D
  3.5        44        1250        R.AFQTLAR.A
  3.1        47        19.2        K.SKSRSSR.A
  2.7        52        1260        R.SMQKLSL.-
  2.0        62        14.2        K.YQKVRN.-
  1.2        73        1236        K.SQRFLR.V
  1.1        75        1236        K.NTRFLR.D
  0.7        82        1250        K.FALKDGR.V
Top scoring peptide matches to query 435
Elution from: 35.63 to 39.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 47009221.3 FinneganScanNumber: 2528
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.4        28        1250        R.LAGVFGSR.G
  4.2        37        1246        K.DMKLKR.K
  4.2        37        1246        R.XDKIKR.S
  4.2        37        1246        R.MDKLKR.Y
  3.9        39        14.4        R.VHALDPR.F
  3.9        40        1246        R.KDLMKR.T
  3.2        47        1236        K.GRFAISR.D
  2.7        52        1246        K.MLKSTAR.S
  2.4        56        1263        MSRRTR
  2.4        56        1263        -.MSTRRR.H
Top scoring peptide matches to query 436
Elution from: 36.25 to 40.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2150452.1 FinneganScanNumber: 2634
Score greater than 31 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 27.8      0.18       -2.52        R.ELGFGSAK.E
 16.9       2.2        2.43        R.TVSTGTSR.S
 16.8       2.3      -16.44        R.VVSXNSR.S
  9.3        13        10.6        -.MATRSSR.R
  9.3        13        10.5        R.RVGMSSR.K
  8.4        16        1263        R.IAGFDER.V
  8.4        16        1227        K.IKMDTAL.-
  8.0        18       -6.69        -.MNSVLTK.H
  8.0        18       -6.71        K.TCSVLTK.N
  7.9        18        1245        R.EIMRSR.Q
Top scoring peptide matches to query 437
Elution from: 34.61 to 38.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18762538.0 FinneganScanNumber: 2385
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1        17        1253        -.MSSKRAK.A
  2.6        38        1257        K.YQKVRN.-
  1.3        52       -8.10        K.RQITYK.G
  1.2        54        5.83        K.LKEQYK.K
  1.0        56        1253        K.RKTMSGK.E
Top scoring peptide matches to query 438
Elution from: 35.10 to 39.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4494545.3 FinneganScanNumber: 2446
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.4       6.4        13.5        R.YSGKARK.R
  4.0        22        4.37        R.LVFKMR.F
  0.2        53        13.5        R.APAALPNR.S
  0.0        55        8.55        K.YVPKFR.R
Top scoring peptide matches to query 439
Elution from: 29.94 to 33.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 797557.2 FinneganScanNumber: 1951
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       4.4        1234        K.TSPKYSK.R
  8.9       9.1        1251        K.QPPGAQGR.G
  8.6       9.8        1220        K.REKYSK.E
  8.1        11      -14.23        R.YAGVFVR.T
  7.7        12       -9.24        R.SHIDALR.E
  7.5        13        18.5        R.LSVDYSK.K
  7.4        13        4.63        K.AYTSNKK.S
  7.0        14       -9.24        K.QPPSNLR.K
  7.0        14        0.47        R.KMSSKSK.K
  7.0        14       -9.23        R.KEEIHR.L
Top scoring peptide matches to query 440
Elution from: 40.89 to 44.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3741454.0 FinneganScanNumber: 3140
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.2       6.1        1229        K.KHIEKR.V
  7.2       6.1        1229        R.KHIKER.E
  5.9       8.2        4.35        K.IIGHMLK.L
  4.2        12        13.5        K.GEPKPRK.L
  3.5        14        1238        R.KXFQIK.S
  1.4        23        1257        M.YSLATKK.G
  1.3        24      -17.56        K.TLSLHLK.D
  1.1        25        1229        K.HLLSGKR.K
  0.9        26       -0.39        R.TPKPGRR.Q
  0.5        28        1229        K.RHILGSK.L
Top scoring peptide matches to query 441
Elution from: 36.28 to 40.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15320947.6 FinneganScanNumber: 2640
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.9       5.2        1230        K.RAPTPIR.E
  5.7       8.6        1230        K.IKEKHR.E
  5.7       8.6        1230        K.LKEKHR.E
  4.6        11        1244        K.LPASLPGR.A
  1.2        24        1244        R.VQPTPLR.Q
Top scoring peptide matches to query 442
Elution from: 36.25 to 40.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15320947.6 FinneganScanNumber: 2634
Score greater than 15 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.8        17      -13.39        R.GRRPGIR.A
Top scoring peptide matches to query 443
Elution from: 36.28 to 40.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15320947.6 FinneganScanNumber: 2636
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.1        13        1230        R.VPRSVPR.T
  3.4        15        1230        K.VSPRVPR.R
Top scoring peptide matches to query 444
Elution from: 41.43 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1108515.3 FinneganScanNumber: 3196
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.4        16        1238        K.SKPARRP.-
Top scoring peptide matches to query 445
Elution from: 20.53 to 24.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 340549.8 FinneganScanNumber: 1097
Score greater than 30 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.9      0.94        13.1        R.LNEVIVK.K
 18.9      0.94       -0.64        K.NIKQAIK.S
 16.2       1.8        1224        K.LLELIGR.G
 16.2       1.8        1241        R.LLGAGRAR.A
 16.2       1.8        1241        R.LLQGARR.I
 15.5       2.1       -0.66        R.KDIVARL.-
 14.4       2.7        1224        R.ILDLALR.N
 14.0       2.9        16.5        K.QVKRQR.S
 13.3       3.5        13.2        K.LIESKPK.V
 13.3       3.5        13.2        K.LLEQALK.T
Top scoring peptide matches to query 446
Elution from: 24.26 to 28.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 557810.8 FinneganScanNumber: 1428
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 23.7      0.54        1236        K.MSAAQALK.K
 22.2      0.77        1236        R.MEKGNIK.W
 16.7       2.7        1236        -.MKALNDK.F
 15.9       3.3        1236        K.MTEIGIR.S
 13.4       5.9        1226        K.FNVLGNR.Y
 12.6       7.1        1213        -.MMVALVR.I
 12.5       7.1        1236        -.MEGLLTR.C
 12.5       7.1        1231        -.MEILWK.T
 12.5       7.1        1236        K.MEKLNGK.E
 12.3       7.5        19.8        -.MGSLSGLR.L
Top scoring peptide matches to query 447
Elution from: 29.31 to 33.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 467327.6 FinneganScanNumber: 1901
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 31.9      0.08       -9.29        R.ITSSRTR.Q
 20.6       1.1       -9.29        R.TSLSRTR.R
 17.4       2.3       -9.27        K.SNTSKKR.K
 17.3       2.3      -14.19        R.LFQEKR.V
 16.8       2.6        4.41        R.SSVITSAR.E
 16.1       3.1        4.41        K.TTVSKER.Q
 15.3       3.7      -14.19        R.YIGALGAR.V
 15.1       3.9        12.4        K.MNKKGAR.I
 14.3       4.6        4.43        K.TSISKER.V
 14.3       4.6      -14.19        QFLEKR
Top scoring peptide matches to query 448
Elution from: 24.18 to 28.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16302880.3 FinneganScanNumber: 1419
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.4       8.5        1216        K.DTSEKLK.Q
 10.7        10        1238        K.MEDGKLK.V
  9.4        13        1238        K.SQMVDLK.S
  9.1        15        1216        K.SKSEEIK.I
  8.9        15        1238        K.EKEVGMK.K
  8.8        16        1224        K.MKVSNNK.K
  8.4        17        1238        R.ELMGGIGK.T
  7.6        20      -17.09        R.IFTPTSR.W
  7.2        23        1238        R.MLSLIGGN.-
  6.9        24        1224        R.MEKEKR.T
Top scoring peptide matches to query 449
Elution from: 36.15 to 40.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2788297.2 FinneganScanNumber: 2616
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.2       5.6       -7.39        R.SMLETIK.K
 11.8       7.9      -17.01        GVFNSGLK
  9.4        13       -7.41        K.LVESVMK.L
  8.8        15        1.59        K.TNTSTGLK.M
  8.7        16        13.7        K.HAPSPNAK.C
  8.3        17      -16.97        K.VLYNANK.N
  7.7        20        1.61        K.DSIGSKSK.K
  7.1        23        1.61        R.TSAAAVSSK.L
  6.8        24        0.55        K.MMGGKGLK.Q
  6.5        27       -3.30        R.EDAVFLK.N
Top scoring peptide matches to query 450
Elution from: 36.22 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2788297.2 FinneganScanNumber: 2629
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.6        16        1238        R.MLSLIGGN.-
  8.5        17        1216        K.DGTISLSK.D
  5.6        32        1215        R.DFRNLR.K
  5.6        32        1232        K.MMRLGGR.L
  5.3        35        13.7        K.HAPSPNAK.C
  3.7        51        1224        R.MNVALTR.G
  3.4        54        1224        R.LQSLGMR.E
  2.7        64        1224        K.MALSGGLR.C
  2.1        72        1228        R.QDALAFR.Q
  1.9        76        1224        -.MAAAATLR.L
Top scoring peptide matches to query 451
Elution from: 25.98 to 29.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6648980.2 FinneganScanNumber: 1612
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.4       5.6        1240        -.MLGQSIR.R
 12.5       6.9        1226        R.LMSARAR.Y
 12.4       7.1        1218        R.ATSQKASK.G
 12.2       7.4        1240        R.LQSLGMR.E
 11.9       8.1        1240        R.QKEMLR.N
 11.8       8.3        1244        K.FGGSSPLR.D
 10.1        12        1244        K.FLGSGSPR.S
 10.1        12        1240        QLEKMR
  9.3        14        1244        R.QDALAFR.Q
  9.3        15        1240        R.KEMQLR.Q
Top scoring peptide matches to query 452
Elution from: 35.63 to 39.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9907847.3 FinneganScanNumber: 2526
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.2       6.4        1224        R.KKFSASR.F
  6.5        12        1224        R.TLPLHSR.D
  6.4        12        1210        K.HGVQVKR.K
  5.6        15        1228        -.MLLATFK.L
  5.3        16        18.1        R.MAKLFAK.Q
  3.7        23        13.5        K.GHAKAAAAK.K
  3.2        25        1210        R.HRELLR.L
  2.9        27       -3.48        K.KTLSTFK.E
  2.9        27       -3.48        R.STKITFK.E
  2.9        27       -3.48        K.TSKLTFK.E
Top scoring peptide matches to query 453
Elution from: 34.67 to 38.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9907847.3 FinneganScanNumber: 2393
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.4       3.8        1210        K.HGVQVKR.K
 10.2       5.1        1224        R.VVQGPAPR.G
  8.3       7.9        13.5        R.AVAGHLTR.A
  7.8       8.9       -3.40        K.KTLSTFK.E
  7.6       9.2        1237        R.TLSFSLR.S
  7.3       9.8        1224        R.KKFSASR.F
  6.5        12        13.5        R.KAGAAGPPR.G
  6.2        13        1210        R.LQKAHAR.K
  6.2        13        1215        R.IKLYMR.R
  6.0        13        1237        K.VYSSVLR.Q
Top scoring peptide matches to query 454
Elution from: 34.62 to 38.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9907847.3 FinneganScanNumber: 2389
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.8       3.5        13.7        K.GHAKAAAAK.K
  9.2       6.4        1224        K.KAKSSFR.D
  7.8       8.9        1237        K.ITITGYR.T
  7.6       9.2        1237        R.SSFLTLR.D
  6.5        12        1232        R.KAFTPFI.-
  6.2        13       -3.28        R.STKITFK.E
  5.8        14        1228        -.MLLATFK.L
  5.7        14        1224        R.KPAPAPSR.S
  5.7        14        1210        R.ELLRHR.D
  5.7        14        1210        M.LELRHR.G
Top scoring peptide matches to query 455
Elution from: 24.28 to 28.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 20635067.2 FinneganScanNumber: 1429
Score greater than 13 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.9        30        2.59        M.APILPGTR.R
Top scoring peptide matches to query 456
Elution from: 24.30 to 28.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 20635067.2 FinneganScanNumber: 1434
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.0       5.8        19.5        R.SGRVLHR.L
  6.1         9        1234        K.KMLFIR.M
  6.1         9        1234        R.KMLFLR.G
  6.1         9        1234        R.MKIFLR.Q
  2.8        19        2.61        K.GILHKEK.L
  0.6        32        2.59        R.GLIPPTAR.I
  0.5        33        5.87        K.SLRRHR.R
  0.1        36        5.87        R.SRIRHR.S
Top scoring peptide matches to query 457
Elution from: 24.58 to 28.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 20630209.0 FinneganScanNumber: 1474
Score greater than 20 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2       5.6        1230        R.LQPRGPR.G
  7.1       7.1        2.60        M.APILPGTR.R
  3.4        17      -11.02        K.SLKIHAR.G
  2.3        22        2.60        K.SQLIVHK.G
  1.8        25        2.62        K.GILHKEK.L
Top scoring peptide matches to query 458
Elution from: 24.22 to 28.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 20635067.2 FinneganScanNumber: 1422
Score greater than 17 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1       9.1        2.77        K.VLLSHGAK.E
  4.3        14        1230        R.ALRGPGPR.S
  3.3        17        2.77        R.VDPIKPR.D
  2.8        19        14.8        R.RWLPPR.R
  2.7        20        19.7        R.VLRHSGR.G
  1.0        29        2.77        M.APILPGTR.R
  1.0        29        2.77        R.GLIPPTAR.I
  0.3        35        2.77        M.VIHSQLK.K
Top scoring peptide matches to query 459
Elution from: 36.32 to 40.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1521486.3 FinneganScanNumber: 2646
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.7         4      -16.72        K.GPPALGASR.G
 11.1       5.8      -16.74        R.QPATPGVR.L
  9.1       9.2       -3.10        K.YSTVLSR.I
  8.4        11        18.4        K.EKFVMR.K
  7.1        15       -3.10        R.IPDPLDR.Q
  7.1        15        18.4        R.IYQMVR.D
  5.9        19      -16.72        R.GPPGAKGNK.G
  4.4        27        0.16        K.TQRAGHR.R
  4.1        29      -16.72        R.QLGPPASR.Q
  3.4        34      -13.46        K.GGHRRSR.K
Top scoring peptide matches to query 460
Elution from: 36.20 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1552168.1 FinneganScanNumber: 2624
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       5.2        18.4        R.YLLMGGR.Y
 11.0       5.9        1222        R.NHGLDLR.L
  9.8       7.7        4.82        K.LRSMFR.A
  9.8       7.7        0.16        K.AHTGRQR.R
  9.8       7.7        18.4        R.SVFMGLR.T
  8.0        12        18.4        K.MYGLGLR.Q
  7.8        12        13.8        K.SAHGGLQR.G
  7.5        13        1231        K.SAFAPFGK.I
  7.4        13        1213        K.MFGGKLR.T
  7.3        14        1236        R.GPPGSQGPK.G
Top scoring peptide matches to query 461
Elution from: 32.32 to 36.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10012009.1 FinneganScanNumber: 2158
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.4       7.4        1236        K.SLAYDKK.K
  8.1        10      -16.99        K.GLGPPKEK.E
  7.3        12        1208        K.HSPTVKR.E
  7.0        13        1208        R.AVAGHLTR.A
  7.0        13        1222        K.NIVEPPR.K
  7.0        13        1209        R.KAGAAGPPR.G
  6.6        14        1225        M.ARRHER.V
  6.4        15        1236        R.TAAVSTFK.G
  5.8        17        1230        -.MFRSKR.S
  5.1        20        1236        R.SNTYVIK.L
Top scoring peptide matches to query 462
Elution from: 32.34 to 36.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10012009.1 FinneganScanNumber: 2162
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.2       3.9        1222        K.NIVEPPR.K
  6.7        14        1204        R.VGPLPWR.R
  4.7        22        1209        R.SSKIPHR.V
  4.2        25        1216        K.RHKMPR.M
  3.5        29       -3.38        K.STLPPPTL.-
  3.4        30        1222        R.IGSPTPPR.L
  3.1        32        1222        K.SAPPSLPR.R
  2.9        34        1209        K.RPVPAER.G
  2.7        35        1208        R.VHAQLTR.H
  1.9        42        1234        K.GFRAAFR.F
Top scoring peptide matches to query 463
Elution from: 36.12 to 40.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4261695.7 FinneganScanNumber: 2612
Score greater than 24 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.1       2.4        1231        R.KAGAAGPPR.G
 11.1       3.7        19.5        R.EPPLELK.D
  8.9       6.1        1218        R.KHAGQKR.T
  8.4       6.9       -7.76        K.GGRLPTPK.L
  8.3         7        5.88        R.APPTSKPK.A
  8.3       7.1       -7.74        R.INSHVKK.K
  8.2       7.2        1214        K.KTLSTFK.E
  7.9       7.7        5.88        R.DSLHLLK.S
  7.9       7.7        19.5        R.LTTSYLK.M
  7.7       8.2       -7.74        R.GAPGLALAR.V
Top scoring peptide matches to query 464
Elution from: 41.37 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 563453.1 FinneganScanNumber: 3190
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.7       4.5      -17.78        R.ALTVGLVR.Q
 11.2       6.3        1217        R.VNLNVLR.E
 10.8       6.9      -17.78        K.VVVVEKR.D
  9.6       9.2      -17.74        R.IAXKIIR.E
  9.5       9.3        12.7        LAELARR
  8.6        12        1217        R.SVIPRQK.V
  8.5        12      -17.76        R.VSLQLLR.T
  8.3        12        1203        R.TLRKPGR.G
  7.3        16        1230        K.VSLQPVGK.F
  6.0        21       -4.17        R.LLPLASSK.N
Top scoring peptide matches to query 465
Elution from: 36.40 to 40.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5155855.0 FinneganScanNumber: 2661
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.5       5.8        1232        K.LETLPVR.A
  8.6        11        13.8        K.KAVANAVR.Q
  8.4        12        1218        K.LQQLLGR.N
  4.3        31      -16.65        K.LIQSIVR.Q
  3.3        38        8.89        R.LAWLAVR.A
  2.6        45      -16.66        R.ALTVGLVR.Q
  2.6        45        0.19        RRELVR
  2.6        45      -16.63        R.EAKLVIR.W
  2.6        45        13.7        R.IGRLVDR.L
  2.6        45        13.7        R.LGRIVDR.M
Top scoring peptide matches to query 466
Elution from: 36.32 to 40.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5155855.0 FinneganScanNumber: 2648
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.4        12        1204        K.NVLRRGL.-
  8.2        12        13.8        R.AAAIARQK.A
  6.9        17        4.84        K.MPRLIAK.V
  6.5        18       -3.06        K.EPTKLLK.K
  6.3        19        1232        K.LETLPVR.A
  6.3        19        1218        K.KQLPSVR.K
  6.2        19      -16.66        R.TVLGIVAR.K
  5.6        23      -16.63        K.EVLRXAK.Q
  5.6        23      -16.63        K.EVLRXAK.Q
  3.9        33      -16.65        K.LIQSIVR.Q
Top scoring peptide matches to query 467
Elution from: 36.32 to 40.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5155855.0 FinneganScanNumber: 2646
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.7       4.4        1232        K.LETLPVR.A
 12.3       4.8        13.7        K.LLVRDGR.R
 12.2       4.9        1204        R.RAPLRSK.I
 11.9       5.2        13.8        R.LELRAAR.S
 11.2       6.2        1204        K.LIVNGRR.L
 11.2       6.2      -16.66        R.VKVDVLR.Q
 11.0       6.5        1204        K.RPTKIGR.R
 10.9       6.6        0.19        K.GRLKQAR.R
 10.6       7.2        1204        R.LNAVVRR.L
  9.6         9        1204        M.RVLNVAR.H
Top scoring peptide matches to query 468
Elution from: 35.70 to 39.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 584921.3 FinneganScanNumber: 2543
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.4       4.6        5.54        R.IHGSMLR.A
 11.1       6.2        1217        K.SSHQTLR.A
  9.5       8.9        1231        R.SPSAPDVR.T
  9.5         9        1204        R.SAAGGRGPR.G
  9.3       9.4        5.56        -.MQKASHK.N
  8.7        11        1204        R.TAPGGGRGR.G
  8.7        11        1204        R.TGPAGGRGR.A
  7.8        13        1217        K.EGKGPNAR.R
  7.5        14        1231        K.QTDHTVK.I
  6.3        19        1212        K.EGLPWAR.K
Top scoring peptide matches to query 469
Elution from: 35.73 to 39.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 584921.3 FinneganScanNumber: 2546
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.5       3.6        1208        K.RMSKYK.E
 11.8       5.3        1204        R.SQPGQRR.E
  7.8        13        1204        K.AGPGSQRR.R
  7.6        14        1204        R.GSAPGRQR.N
  7.1        16        1204        R.AGAGSPGRR.R
  7.1        16       -8.00        -.MAAAGPRR.S
  7.1        16        1217        R.TGPAGAAGAR.G
  6.9        16        5.54        K.SMLVHSR.H
  6.7        17        9.63        R.APASAAWR.S
  6.6        18      -15.90        R.SQALPTGR.D
Top scoring peptide matches to query 470
Elution from: 41.36 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8499743.5 FinneganScanNumber: 3189
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.6       2.1        1202        LAELARR
 14.7       4.2        1216        R.VPLSASVR.S
 14.5       4.4        1202        K.KAVANAVR.Q
 13.7       5.3        1202        R.AAAIARQK.A
 12.6       6.8        1202        R.AAPKGTKR.D
 12.1       7.6        13.3        R.LAAAAREK.L
 12.1       7.6        13.3        R.RGIALDGK.I
 12.1       7.6        13.3        K.RGLALDGK.L
 10.7        11      -17.09        R.QLTGLGLK.V
 10.2        12        1202        R.LRVGVER.S
Top scoring peptide matches to query 471
Elution from: 32.91 to 36.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10749771.9 FinneganScanNumber: 2211
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.1       9.5       -0.23        R.IGRAGTVR.R
 11.1       9.5       -0.21        K.NLVATRR.S
 10.7        10        1202        R.KAGGGLIGR.K
  9.2        15      -17.03        K.ITEVLVR.K
  9.2        15        1216        R.VSASPVLR.L
  8.9        16        1216        K.ILAEGGIR.G
  8.3        18      -17.05        K.TKPTGVVK.S
  7.9        20        13.3        R.GLNISAVR.L
  7.9        20       -0.21        R.QRISVAR.A
  7.7        21        1203        K.KAVANAVR.Q
Top scoring peptide matches to query 472
Elution from: 36.22 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5840962.6 FinneganScanNumber: 2628
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.6       4.3        1203        R.AAAIARQK.A
 13.4       5.7       -3.36        K.IIVDELK.Q
 10.4        11        13.5        R.LAAAAREK.L
 10.1        12      -16.89        R.EKSPKLK.N
 10.1        12      -16.89        R.KSEPKIK.K
  9.5        14       -3.36        K.VILDELK.C
  8.8        16       -0.10        K.ARARVEK.W
  8.7        16       -0.12        K.NLVATRR.S
  8.6        17        1216        R.VPLSASVR.S
  7.8        20        1203        K.LLVRDGR.R
Top scoring peptide matches to query 473
Elution from: 36.43 to 40.44 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 500855.8 FinneganScanNumber: 2665
Score greater than 29 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.6      0.96        1203        -.MAVVSAVR.W
 15.2       4.2        1226        R.EVLGSATR.D
 15.0       4.3        1203        -.MGLVVSAR.S
 13.7       5.9        1212        K.SDLVRSR.E
 12.1       8.5        1203        -.MSTIPKR.A
 11.3        10        1203        -.MATAAVLR.G
 11.1        11        1207        R.AFDVPKR.Y
 10.0        14        1190        -.MASVRIR.E
  9.7        15        1226        R.SKVDDLR.G
  9.7        15        1226        K.SKVDLDR.L
Top scoring peptide matches to query 474
Elution from: 24.37 to 28.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2483820.1 FinneganScanNumber: 1445
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 475
Elution from: 24.30 to 28.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2483820.1 FinneganScanNumber: 1435
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 476
Elution from: 36.64 to 40.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2184194.3 FinneganScanNumber: 2700
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.7        14        9.20        -.MDRVGGGK.G
  7.3        19        1190        K.MNARQSK.C
  6.7        22        9.23        K.NGQMKNK.D
  5.8        27       -7.44        K.ELEGLMK.T
  5.5        29        1217        K.TLPECSK.L
  4.2        38        1195        R.KMPMPSK.R
  4.2        39        1196        K.DVEEKSK.E
  3.9        41        1203        R.RAEMLTGG.-
  3.8        43        13.8        R.MSMIPPK.I
  3.5        45        1203        -.MSVTGPAR.C
Top scoring peptide matches to query 477
Elution from: 18.85 to 22.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 422786.1 FinneganScanNumber: 981
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 30.3       0.1       -5.87        K.MASRARK.A
 22.6      0.62        1202        -.MRELAAK.S
 18.8       1.5        11.6        K.FASNIQR.T
 18.8       1.5        1215        -.MVLADAAK.M
 18.6       1.6       -5.89        -.MAGTRRK.S
 18.5       1.6       -6.70        M.FRFHTK.K
 17.8       1.9        1215        K.AEGTVVMK.L
 14.1       4.4      -18.55        R.FLGLTER.D
 13.2       5.4        1202        K.SEAMLRK.H
 12.5       6.4      -18.58        K.QTGVFGVK.I
Top scoring peptide matches to query 478
Elution from: 36.28 to 40.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1144100.1 FinneganScanNumber: 2638
Score greater than 27 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.9       1.5        14.1        R.GLVAEGHR.L
 13.1       3.5       -8.10        -.MFRTKR.S
 10.8         6        1217        -.XSSFDLR.K
 10.8         6        1217        -.XSSFDLR.K
 10.0       7.2        1217        M.LSFVDTR.T
  8.8       9.6        1182        K.MHAIPLR.S
  7.4        13        1199        R.ISWYLR.D
  7.3        13        1213        K.SXMLQKK.K
  7.3        13        14.1        R.GPGPGAVQR.E
  6.8        15        1217        R.TVFVSER.E
Top scoring peptide matches to query 479
Elution from: 36.20 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1144100.1 FinneganScanNumber: 2626
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.7       4.8        1204        R.GPSPPLNR.R
  8.5        10        1213        -.MTVGKSSK.M
  6.0        18        1195        -.MLASFLR.T
  5.3        21        1191        R.HNLAQVR.-
  5.2        22      -15.92        R.GPTGKPGPK.G
  5.1        22        1191        R.SAPGPRPR.A
  5.0        23        5.31        K.SAVMRFK.K
  4.8        24        1191        K.AGPSPPRR.G
  4.6        25        1213        K.MKDTSKK.N
  4.5        25        1209        R.LMFAVEK.S
Top scoring peptide matches to query 480
Elution from: 36.25 to 40.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1144100.1 FinneganScanNumber: 2631
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.7       2.5        14.2        R.SEYRKR.G
 13.0       3.6        1195        -.MLASFLR.T
 11.9       4.7        1217        K.DLSSIFR.G
 10.5       6.4        14.1        R.YRDTKR.A
 10.4       6.5        1195        K.MGFTIIR.K
  8.7       9.6        14.1        R.GPGPGAVQR.E
  8.6       9.9        1204        R.HEVSLPR.Q
  8.3        11        1204        K.HPSVLER.Q
  7.8        12        1182        -.MRIVYR.M
  7.8        12        1195        K.MIFSALR.F
Top scoring peptide matches to query 481
Elution from: 23.73 to 27.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1985115.0 FinneganScanNumber: 1377
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.8       0.6       -0.40        K.LSVEAPPK.I
 17.6         1      -13.79        K.ISSHVLGK.E
 13.8       2.5        16.2        K.LSTHLGGR.C
 11.1       4.5        1203        R.AQSPLPAR.H
 10.5       5.2        1203        R.VTDLVHR.E
  8.6         8      -13.78        K.QNAAPLVK.Y
  8.5       8.3        1217        K.EAIHELK.Y
  8.1       8.9        2.78        R.RGQPVAGR.F
  7.1        11        1203        K.QAVHKEK.R
  6.8        12        1217        K.LSSYTLR.I
Top scoring peptide matches to query 482
Elution from: 36.28 to 40.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1222987.4 FinneganScanNumber: 2638
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.5       4.5      -12.68        K.VKSGTPPR.Q
 11.5       4.5        17.3        R.GGVREAPR.G
 10.7       5.5        1203        R.SVLHQTR.S
 10.7       5.5        1203        R.AAQAGLGPR.A
 10.6       5.5        1176        R.RRGAAGPR.I
 10.2       6.2        1203        K.ALQGAAGPR.L
  8.8       8.4        1198        K.GFGKLYR.K
  8.7       8.7        1189        R.RGQPVAGR.F
  8.6       8.8        1189        R.QQGPRVR.R
  8.2       9.6        17.3        R.GRGIDPAR.T
Top scoring peptide matches to query 483
Elution from: 35.32 to 39.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1222987.4 FinneganScanNumber: 2479
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.2       3.2        1199        R.SLTPLPGR.G
  9.6       5.8        1215        R.RGQPVAGR.F
  5.2        16       -0.38        R.RPATLQR.K
  3.9        22        1215        R.ARGPGVGAR.L
  2.7        28       -0.38        R.RTLPAQR.E
  2.2        32       -0.40        K.RSAGVPVR.G
  1.3        39      -13.72        R.RPERKR.E
  0.3        50      -13.74        R.GRSLPRR.R
  0.2        50        1185        R.TLPTRPR.W
  0.2        51        1202        K.GRRAAGPR.R
Top scoring peptide matches to query 484
Elution from: 24.11 to 28.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3737163.7 FinneganScanNumber: 1412
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 485
Elution from: 26.64 to 30.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 590190.0 FinneganScanNumber: 1677
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 486
Elution from: 33.07 to 37.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11527343.2 FinneganScanNumber: 2227
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 25.6      0.19        15.9        R.RKAGSAPR.R
 22.9      0.35        15.9        R.RQVGVQR.M
 20.4      0.62        1200        -.PAGTLARR.A
 15.5       1.9        15.9        K.VGGGLRQR.R
 13.6       2.9        15.9        R.GGGGAIRVR.R
 13.0       3.4      -13.97        R.LGLRLDR.T
 12.9       3.5      -13.97        K.RDILLGR.L
 11.9       4.3        1213        R.AVALGTGPR.G
 11.2       5.2        15.9        R.GSKARAPR.A
 11.0       5.3        1200        R.SLVPNRR.T
Top scoring peptide matches to query 487
Elution from: 33.51 to 37.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11425159.5 FinneganScanNumber: 2272
Score greater than 27 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.9      0.86        1200        R.VRLSNPR.G
 18.7      0.92       -0.54        K.VAGAATPKK.S
 13.6         3       -0.54        K.RLVTPEK.V
 12.4       3.9      -13.89        R.IGRLVER.L
 12.2       4.1       -0.54        K.VELPTKR.L
 11.1       5.3      -13.89        R.LGLRLDR.T
 11.0       5.3        1200        R.RNVLPSR.G
 10.9       5.5        12.8        R.GISLLPDK.A
 10.9       5.5       -0.54        K.LEKTVPR.L
 10.7       5.7        1187        R.GRRLSPR.T
Top scoring peptide matches to query 488
Elution from: 39.10 to 43.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6211765.4 FinneganScanNumber: 3020
Score greater than 28 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.8       1.8      -13.68        R.LGLRLDR.T
 14.6       2.4        1214        R.LGPAGASLR.R
 13.4       3.1      -13.68        K.LGQIGRAK.R
 13.3       3.1        1214        K.LGSPAQLR.T
 12.1       4.1        1200        R.IRAPSAAR.S
 11.8       4.4        1200        R.VVTRNPR.K
 10.9       5.4      -13.68        R.IGRLVER.L
  9.6       7.4        1214        R.LGQPLTGR.R
  9.6       7.4        1200        R.TVPAARAR.E
  8.8       8.8        1214        R.AKVAPAER.M
Top scoring peptide matches to query 489
Elution from: 37.19 to 41.20 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3973611.8 FinneganScanNumber: 2798
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.5        36        1214        R.SHAGKKTL.-
  0.5        58       -0.25        -.LPSSGLLR.S
Top scoring peptide matches to query 490
Elution from: 36.09 to 40.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2930747.3 FinneganScanNumber: 2606
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.4       1.1       -0.17        K.VELPTKR.L
 17.2       1.1       -0.17        K.VAGAATPKK.S
 15.0       1.8       -0.17        K.LEKTVPR.L
 13.9       2.4       -0.15        K.KELSLPR.R
 13.7       2.5       -0.15        K.ELKSIPR.L
 13.3       2.7      -13.51        K.RDILLGR.L
 13.3       2.7       -0.19        R.VQQVLAGK.S
 13.1       2.8        16.4        M.GGGRGLLGR.E
 12.2       3.5        16.4        K.VGGGLRQR.R
 11.7       3.9        7.59        R.LRGLMPR.S
Top scoring peptide matches to query 491
Elution from: 30.05 to 34.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15992220.3 FinneganScanNumber: 1959
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.5       1.7       -0.10        K.KELSLPR.R
 14.2       2.2        1201        -.XAQRGPGK.A
 13.4       2.7        7.64        R.LRGLMPR.S
 12.8         3       -0.12        K.LEKTVPR.L
 12.4       3.4        11.6        R.KKAWGPR.D
 11.6       4.1      -13.47        R.KLSGPKGR.R
 11.1       4.5        1201        R.VRLSNPR.G
 10.8       4.9        1187        K.RLGRSPR.I
 10.7       4.9        1187        R.RLGSRPR.R
  9.8       6.1       -0.10        K.ELKSIPR.L
Top scoring peptide matches to query 492
Elution from: 27.09 to 31.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 31130925.8 FinneganScanNumber: 1722
Score greater than 29 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.9      0.74       -0.04        K.VAGAATPKK.S
 15.5       1.7      -13.38        R.LGLRLDR.T
 14.8       1.9       -0.02        K.KELSLPR.R
 13.7       2.5      -13.38        R.VLARLDR.D
 12.9         3        13.3        R.GLSLPDIK.V
 12.2       3.5       -0.04        K.LEKTVPR.L
 12.2       3.5        13.3        R.GISLLPDK.A
 11.9       3.7       -0.05        VAGIIDVR
 11.2       4.4       -0.02        K.ELKSIPR.L
 11.0       4.7        1187        R.GRRLSPR.T
Top scoring peptide matches to query 493
Elution from: 27.04 to 31.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 30897275.4 FinneganScanNumber: 1719
Score greater than 27 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.5       1.6        13.3        R.VLSPPTTK.R
 13.2       2.8       -4.82        K.WLISPVK.I
 12.7       3.1        1201        R.APRSAALR.L
 12.6       3.2        16.5        R.GGGGAIRVR.R
 11.8       3.8      -13.38        K.LGQIGRAK.R
 11.5       4.2       -0.03        K.LEKTVPR.L
 11.4       4.2       -0.03        K.VAGAATPKK.S
 10.3       5.5        13.3        R.DSPLLLGK.K
  9.6       6.5        1184        K.NPLAVSKI.-
  9.1       7.2      -13.38        R.IGRLVER.L
Top scoring peptide matches to query 494
Elution from: 24.26 to 28.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 305575137.1 FinneganScanNumber: 1427
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.2       2.2        1.80        K.ELKSIPR.L
 14.2       2.2        1.80        K.KELSLPR.R
 13.8       2.4        1.78        K.LEKTVPR.L
 13.1       2.8        1189        R.LRGSRPR.G
 12.8       3.1        1202        K.DRPIRGK.E
 12.8       3.1        1202        -.PAGTLARR.A
 12.7       3.1        18.3        K.VGGGLRQR.R
 11.9       3.8        1202        R.IRAPSAAR.S
 11.8       3.8        1186        K.LVGISQPK.Y
 11.6         4        9.55        R.LRGLMPR.S
Top scoring peptide matches to query 495
Elution from: 24.11 to 28.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 305575137.1 FinneganScanNumber: 1412
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.4      0.66        1203        K.DRPIRGK.E
 18.3      0.85        1203        -.PAGTLARR.A
 16.4       1.3        1.87        K.VAGAATPKK.S
 15.0       1.8        1.87        K.LEKTVPR.L
 14.9       1.9        1.85        VAGIIDVR
 14.1       2.3        1203        R.VRLSNPR.G
 12.8       3.1        18.4        M.GGGRGLLGR.E
 12.5       3.2      -11.49        K.GGKKTPVR.S
 12.5       3.3        1.89        K.ELKSIPR.L
 12.5       3.3        1.89        K.KELSLPR.R
Top scoring peptide matches to query 496
Elution from: 24.06 to 28.05 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 305575137.1 FinneganScanNumber: 1403
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.4      0.42        1203        R.TALRGAPR.L
 20.9      0.47        1.89        K.ELKSIPR.L
 17.9      0.95        1.87        K.VAGAATPKK.S
 17.6         1        1203        K.TSPRKPR.G
 17.5         1        1.87        K.LEKTVPR.L
 16.0       1.5        1203        R.TVPAARAR.E
 15.8       1.5        1.89        K.KELSLPR.R
 14.0       2.3        1203        K.RGGSLPVR.H
 12.7       3.1        1189        R.RTRGVPR.G
 12.5       3.3        1.85        VAGIIDVR
Top scoring peptide matches to query 497
Elution from: 24.02 to 28.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 305575137.1 FinneganScanNumber: 1400
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.2       0.7      -11.48        R.IGRLVER.L
 18.6       0.8        18.4        K.VGGGLRQR.R
 17.9      0.93        1203        R.RNVLPSR.G
 13.8       2.4        1.87        K.LEKTVPR.L
 13.2       2.8        1211        K.LSLPHFK.E
 12.8         3      -11.48        K.RDILLGR.L
 11.6         4        1.89        K.KELSLPR.R
 11.6         4        5.06        R.RGRVAGAR.V
 11.5       4.1        1.89        K.ELKSIPR.L
 11.5       4.1        1203        R.TVPAARAR.E
Top scoring peptide matches to query 498
Elution from: 30.40 to 34.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5134261.7 FinneganScanNumber: 1985
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.1       0.6        1192        K.VAGAATPKK.S
 19.3       0.9       -4.42        K.IGTIQRR.L
 17.9       1.3        1208        K.VGGGLRQR.R
 16.2       1.8        8.93        R.VALKQER.G
 16.2       1.8        7.33        R.VARWRR.L
 13.2       3.6        1199        R.LRGLMPR.S
 12.6       4.2        1205        R.GISLLPDK.A
 12.1       4.8        8.89        R.ITGIGLGGR.A
 11.6       5.3        1178        K.RDILLGR.L
 11.4       5.5        0.14        R.ILTMLPR.L
Top scoring peptide matches to query 499
Elution from: 24.37 to 28.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2515248.3 FinneganScanNumber: 1446
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 500
Elution from: 20.74 to 24.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 405488.9 FinneganScanNumber: 1114
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.7        11      -13.81        R.AIRENSR.A
  7.7        23       -5.30        R.WPSAASVK.S
  7.3        24        12.8        R.QLAEEAGK.S
  6.2        31      -18.61        K.AGQIPGFR.E
  5.9        34       -0.51        R.AALAQSER.S
  4.8        43        15.9        M.QGRQGGSR.S
  4.8        44        12.8        R.EGAPSKEK.W
  3.9        53        12.8        K.EKPESAGK.A
  3.2        63       -0.56        R.VVGGTEAGR.N
  2.7        71        1201        K.ALSSMHAK.N
Top scoring peptide matches to query 501
Elution from: 36.43 to 40.44 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 925151.3 FinneganScanNumber: 2667
Score greater than 23 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.2       2.7        1194        K.KSRLVNK.Q
 10.2       4.3        5.14        K.KMLKVAR.E
  8.9       5.8      -15.89        K.KLLRTXK.Q
  8.9       5.8       -2.57        K.KLLSEKK.L
  8.4       6.6        9.12        K.FRGLPKK.Q
  7.3       8.3       -2.57        K.ELKKSLK.I
  7.3       8.3       -2.57        K.KLEKSIK.F
  7.3       8.3       -2.59        K.KLKIDTK.E
  7.3       8.3       -2.57        R.KLSKLEK.T
  7.3       8.4        5.14        R.LKMKGIR.N
Top scoring peptide matches to query 502
Elution from: 36.43 to 40.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 925151.3 FinneganScanNumber: 2664
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.1       6.9       -2.59        K.LTLKKDK.F
  8.1       6.9       -2.59        TLLKKDK
  7.8       7.6        1207        R.LRDSLIK.M
  7.6       7.9        1207        R.LVNSGKVK.R
  7.4       8.2        18.4        K.IMILLSR.K
  7.3       8.4        1207        R.VLSLSGIR.E
  7.2       8.5      -15.89        R.LTIKKSR.D
  7.1       8.7        1207        R.TLLLASAR.V
  7.0         9        1207        K.TVLGIVSR.G
  6.9       9.3        1177        K.TIEKIIK.I
Top scoring peptide matches to query 503
Elution from: 21.51 to 25.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 597639.0 FinneganScanNumber: 1176
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.4       2.4        1182        R.RGAEADAR.D
 15.7       2.8        1203        R.RGCEPAR.E
 15.5       2.9        16.4        R.ENNNISR.E
 13.2         5        1182        R.EREGQAR.L
 12.5       5.9        7.64        R.IPMEGQR.D
 12.4         6        1182        K.AQNSQAAR.Q
 11.3       7.8        7.64        R.MGLGPESR.I
 11.1       8.1        7.62        -.MSGPVPSR.A
 10.3       9.8        7.64        -.MDQPLSR.S
  9.9        11      -10.43        LPFCGPR
Top scoring peptide matches to query 504
Elution from: 35.73 to 39.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 334192.6 FinneganScanNumber: 2545
Score greater than 20 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.1        23        1177        R.LPTAASASK.Q
  7.2        36        14.5        R.GRGSGLSGR.R
  5.9        48        1180        R.RGATRER.V
  5.6        51        14.5        R.ERTRER.E
  5.6        51      -15.26        R.TDSRLVR.S
  5.5        53        1206        R.TTTAAPQR.W
  5.4        54        1177        R.TGPVSVGTK.K
  5.2        56      -15.26        R.AGRSAVGTK.M
  4.7        63        1206        R.LPAGTSGSR.G
  3.9        75        1193        R.GREKAER.E
Top scoring peptide matches to query 505
Elution from: 26.39 to 30.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1257526.3 FinneganScanNumber: 1648
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.3      0.98        1188        R.RKMIGSR.T
 19.1         1      -13.20        K.RVYAALR.A
 13.9       3.4        1202        K.KVNMISR.E
 11.3       6.1        1167        R.KSRTLSR.R
 10.9       6.7        0.04        K.DVKFALR.K
 10.3       7.7        0.04        R.AFLTGLAR.S
 10.3       7.7        13.3        K.FIDIAAAK.E
 10.3       7.7        1202        K.MAAISKAR.G
 10.2         8        1181        K.AVSSKSLR.H
 10.2         8        1181        K.SVASKSIR.R
Top scoring peptide matches to query 506
Elution from: 26.42 to 30.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1257526.3 FinneganScanNumber: 1653
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.8       2.8        1194        R.KSKEIDK.C
 11.1       6.5        1194        K.LVTSKGDK.E
 10.7       7.2        1167        R.KSRTLSR.R
  9.1        10        1189        R.VYLLPDK.R
  8.7        11        13.3        R.VPLYTQK.D
  8.1        13      -13.22        K.VNLHLPR.F
  7.6        15        1189        K.VYIDPLK.R
  7.0        16        1181        K.SLSSGLRK.G
  6.4        19        1176        R.FNLNLVK.T
  6.0        21        1202        K.KVNMISR.E
Top scoring peptide matches to query 507
Elution from: 24.79 to 28.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 834970.3 FinneganScanNumber: 1498
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 508
Elution from: 28.76 to 32.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 219354.1 FinneganScanNumber: 1850
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.6       8.8       -5.58        -.MAALGCAR.L
  6.4        18        16.4        -.MGNQLDR.I
  5.7        21        1170        K.DSSSPSLR.S
  5.6        22        16.4        K.MREDGGGK.D
  4.7        27        1165        K.WATDDIK.S
  4.7        27        1191        -.MAAAAEER.M
  4.7        27        16.4        R.GQACSAQK.A
  4.4        29        8.69        K.VSSEGNEK.G
  4.3        29        1170        K.LSQTEDR.Q
  3.9        33        1195        R.DSYGGPPR.R
Top scoring peptide matches to query 509
Elution from: 24.34 to 28.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2390134.3 FinneganScanNumber: 1442
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 510
Elution from: 24.34 to 28.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2390134.3 FinneganScanNumber: 1443
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 511
Elution from: 27.92 to 31.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 612004.1 FinneganScanNumber: 1788
Score greater than 23 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.6       4.2       -0.10        R.LKSSFLR.G
  9.4       5.6        1202        K.VPLEVHR.K
  8.5       6.8        1173        R.VSYVLLR.R
  8.3       7.2        1203        K.KAYAQIR.V
  8.2       7.3        13.1        K.TQTIFLK.Y
  7.6       8.5        1202        R.GTFQKLR.E
  6.8        10        1203        R.GSKAAFLR.Q
  6.1        12        1202        R.VDLHLPR.F
  5.7        13        1202        R.FQKGTLR.M
  4.9        16        1173        R.YLTLAIR.M
Top scoring peptide matches to query 512
Elution from: 25.08 to 29.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1338660.9 FinneganScanNumber: 1531
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.2        13        1195        R.LHITIPR.R
Top scoring peptide matches to query 513
Elution from: 25.08 to 29.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1338660.9 FinneganScanNumber: 1533
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 514
Elution from: 31.18 to 35.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 2061
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.5        14        1174        R.AGPQPPAGR.A
  7.0        20        19.0        K.MRGMRGK.I
  7.0        20        1170        K.MSQKGKR.K
  7.0        20        1175        K.TTTGITEK.V
  4.6        35      -14.26        K.NNTYLVK.R
  3.5        46       -7.39        K.FPVFWR.E
  2.9        52      -14.28        K.QXDPGLPK.M
  2.6        56        1200        K.ENVYTPK.S
  2.3        60      -14.28        K.SFDQKVK.E
  2.3        60      -14.28        R.SKDFQVK.K
Top scoring peptide matches to query 515
Elution from: 38.62 to 42.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5209270.9 FinneganScanNumber: 2988
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.1       5.4        1185        K.NISKKFGG.-
  7.3        13        1185        K.SLTAGVFR.E
  7.3        13        1171        R.SLTARFR.R
  7.3        13        1185        R.AFSLKER.A
  5.5        19        1171        K.LGRTTFR.L
  5.5        19        1188        K.MLRKMR.D
  5.5        19        1192        -.MQLRFR.G
  5.5        19        1196        K.RFPQFR.K
  5.5        19        1188        M.RLKMMR.T
  5.5        19        1196        K.RPFGAFR.S
Top scoring peptide matches to query 516
Elution from: 35.96 to 39.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 35018641.6 FinneganScanNumber: 2587
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2        10      -19.99        KMKVTTK
  7.1        13      -19.97        R.KLKMSTK.I
  5.9        18        13.6        K.LEISPHR.K
  5.5        19        0.36        R.HKSKHSK.D
  5.3        20        13.5        R.QSPPLPGR.E
  5.1        21        13.6        YTGIRNK
  4.3        25        0.36        R.GRXYRTK.Y
  3.5        30      -16.02        R.FLQSKTK.R
  2.0        43        1185        K.YLGIQTR.V
  1.1        54        0.34        R.LLQQGHR.C
Top scoring peptide matches to query 517
Elution from: 35.34 to 39.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 35018641.6 FinneganScanNumber: 2483
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.1        21        1198        K.VYEQLAK.Y
Top scoring peptide matches to query 518
Elution from: 35.32 to 39.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 35018641.6 FinneganScanNumber: 2478
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8        11        1172        K.YKDLRR.S
  5.8        18        1198        K.ISDFGLAK.C
  4.8        22      -16.00        K.VYKVTNK.R
  4.7        23        1172        R.YGRLVSR.Q
  4.5        24        13.6        R.HSSAPPKK.K
  4.4        25        1198        M.SDKLPYK.V
  4.1        27        13.6        TNSRFVK
  4.0        27       -2.79        K.EYTIVVK.V
  4.0        27      -16.00        K.YQSKVVK.T
  3.9        28      -15.98        R.DKYGIKK.K
Top scoring peptide matches to query 519
Elution from: 35.43 to 39.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 35018641.6 FinneganScanNumber: 2496
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.8        18        0.40        R.HKSKHSK.D
  5.0        21        1189        R.RMLMKR.L
  1.3        51        0.40        K.AFSKRSR.L
  1.1        53        0.40        K.AFSRKSR.L
  0.2        66        1185        K.TLGLAGYR.S
Top scoring peptide matches to query 520
Elution from: 36.28 to 40.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 35018641.6 FinneganScanNumber: 2635
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.7        29        14.2        R.LMMSLLK.D
  3.7        29        1185        K.IYKPSSR.F
Top scoring peptide matches to query 521
Elution from: 36.61 to 40.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1502511.2 FinneganScanNumber: 2694
Score greater than 27 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.1      0.89        1170        R.NSVGYRR.C
 19.3       1.1        1166        R.MRTSKGR.A
 12.9       4.7        4.65        -.MTPPPPGR.A
  9.1        11        1175        -.MDIIFGR.N
  9.1        11        1175        -.MDLLFGR.R
  7.7        15        1170        K.FARNTSR.I
  7.4        16        1184        K.YQLTNGR.S
  7.0        18        1170        K.GTQRSFR.K
  6.8        19        1192        K.MMIMLGR.W
  6.6        20        1171        R.MLATIMR.R
Top scoring peptide matches to query 522
Elution from: 35.96 to 39.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15307057.5 FinneganScanNumber: 2587
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.7        11        14.0        R.LFRMASK.D
  5.9        13        1193        K.LEISPHR.K
  5.5        14        1180        R.HKSKHSK.D
  5.3        15        1193        R.QSPPLPGR.E
  5.1        16        1193        YTGIRNK
  4.3        19        1180        R.GRXYRTK.Y
  4.3        19        6.30        R.SKEFLTK.Q
  4.0        20      -11.62        K.LANFFLK.-
  3.6        22       -6.91        R.SLHLPGTK.G
  3.5        22        1163        R.FLQSKTK.R
Top scoring peptide matches to query 523
Elution from: 35.84 to 39.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4160334.3 FinneganScanNumber: 2565
Score greater than 13 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.5        25        1169        R.LEHGIKR.R
  0.5        41        1198        K.NQKAHVR.I
  0.2        43        13.0        R.ALVPGGSPR.G
  0.1        45        1169        K.LEKGHLR.G
  0.1        45        13.0        R.QPGSLPVR.L
Top scoring peptide matches to query 524
Elution from: 36.62 to 40.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9224937.4 FinneganScanNumber: 2699
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.7       7.5        12.6        K.NKPVELR.C
  7.1       8.6       -0.52        R.AAPRTAIR.A
  6.1        11        1179        R.TLLSAPPR.Q
  3.7        19        1179        R.EAVPGILR.A
  3.7        19       -5.26        K.HFIGIIR.M
  2.9        22        12.6        K.APALTNIR.E
  1.2        33        12.6        R.GSPPTKLR.R
  1.2        33        1179        K.KLVTEHK.D
  1.1        34        1179        K.SSPVIPVR.S
  0.1        43        1166        R.IEPLRAR.K
Top scoring peptide matches to query 525
Elution from: 36.61 to 40.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9224937.4 FinneganScanNumber: 2694
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.3        16        1195        K.GRAVAPGAR.G
Top scoring peptide matches to query 526
Elution from: 36.67 to 40.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9224937.4 FinneganScanNumber: 2706
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.6       4.9        12.6        K.NKPVELR.C
  8.9       5.7        1179        R.TLLSAPPR.Q
  8.0         7        12.6        R.INRLPDK.N
  6.6       9.7        1166        R.QLVRNKP.-
  5.3        13        1166        R.IEPLRAR.K
  4.6        15        1192        K.ALPTLDPK.I
  3.0        22        1179        K.SSPVIPVR.S
  2.9        23        1166        R.TLISHKR.V
  2.3        26        12.6        R.GSPPTKLR.R
  2.3        26        1179        K.KLVTEHK.D
Top scoring peptide matches to query 527
Elution from: 24.59 to 28.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 105606058.8 FinneganScanNumber: 1476
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 25.0      0.19        1168        R.RGGGKKPR.R
 22.0      0.37        0.07        R.VTIASLPR.N
 18.0      0.95        1194        R.VNALVSPR.Q
 16.5       1.3      -13.04        R.IAQKQIR.R
 15.5       1.7      -13.04        K.RDILALR.V
 14.3       2.2        16.3        R.RQAVGAVR.F
 14.2       2.3        0.11        K.EAALIALR.S
 13.4       2.8        1194        R.VVGVTQPR.R
 12.1       3.7        0.09        K.ALLSPSLR.G
 12.1       3.7        1194        K.VNLSGLPR.D
Top scoring peptide matches to query 528
Elution from: 24.63 to 28.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 105606058.8 FinneganScanNumber: 1478
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 24.6      0.21        0.07        R.VTIASLPR.N
 21.6      0.42        0.09        K.SPLSLIAR.F
 18.5      0.84      -13.03        K.RDILALR.V
 16.9       1.2        0.11        K.EAALIALR.S
 16.9       1.2      -13.03        R.RLDIALR.N
 13.8       2.5        16.4        R.LAGAVRNR.S
 13.6       2.6        1181        R.RAVLGSPR.V
 13.5       2.7        16.4        R.RNNAILR.A
 12.8       3.1        16.4        R.RINANIR.E
 12.8       3.2        1181        K.TVRAVGPR.S
Top scoring peptide matches to query 529
Elution from: 24.63 to 28.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 105606058.8 FinneganScanNumber: 1477
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.5      0.67        0.07        R.VTIASLPR.N
 18.6      0.83        16.4        R.LAGAVRNR.S
 17.4       1.1        0.11        K.EAALIALR.S
 17.3       1.1      -13.03        K.RDILALR.V
 16.6       1.3        1194        R.LRDLGPGK.S
 15.4       1.7      -13.03        R.RLDIALR.N
 12.0       3.7        1181        R.LVGRASPR.E
 11.3       4.4      -13.03        R.IAQKQIR.R
 11.1       4.6      -13.03        R.LKKSQPR.T
 11.1       4.6        0.07        R.LLGLSTPR.N
Top scoring peptide matches to query 530
Elution from: 24.64 to 28.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 105606058.8 FinneganScanNumber: 1482
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.6       3.3      -13.03        R.IAQKQIR.R
 11.6       4.1        0.08        R.VTIASLPR.N
 11.2       4.5        0.10        K.ALLSPSLR.G
 10.9       4.8      -13.03        K.RDILALR.V
 10.2       5.6        16.3        R.RQAVGAVR.F
 10.2       5.7        0.10        K.SPLSLIAR.F
  9.7       6.5      -13.03        K.ALVERLR.D
  9.4       6.8      -13.01        R.NKAAALLR.L
  9.2       7.1        1168        K.KRPNRGK.A
  9.2       7.2        0.11        K.EAALIALR.S
Top scoring peptide matches to query 531
Elution from: 29.10 to 33.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 754369.8 FinneganScanNumber: 1881
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.9        29      -17.61        R.GVTMKGPR.L
  6.5        32        1178        R.RDREER.L
  3.9        59       -8.97        K.NSARASQK.Q
  2.4        82        1149        K.TREVAER.K
  2.4        82        11.6        R.GVDRCVR.A
  2.4        83        1162        R.LVNETRE.-
  2.1        87        1149        K.IAKNSDGR.E
  2.0        90        1149        R.RASLEER.A
  1.5     1e+02        1162        R.IPDTATSR.D
  1.2   1.1e+02        11.6        R.QTMGRPR.A
Top scoring peptide matches to query 532
Elution from: 29.54 to 33.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 690244.7 FinneganScanNumber: 1921
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.3       5.4        1155        R.LTTPVFGK.G
 10.8       7.6        1184        R.NTAKPGFK.H
 10.8       7.6        17.0        M.SQLSSTLK.R
 10.3       8.6        1167        -.MGLLTRR.K
  7.4        17        1184        K.GFLEALGR.L
  7.3        17        1180        -.MALVASVR.V
  6.6        20      -13.74        R.QYRVLGK.G
  6.6        20       -0.70        R.ELLLYGR.K
  6.5        21        3.95        K.STKASKGGK.S
  6.3        21        3.95        K.SKSKTQGK.Q
Top scoring peptide matches to query 533
Elution from: 24.81 to 28.81 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 756564.2 FinneganScanNumber: 1502
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 534
Elution from: 21.12 to 25.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1914648.4 FinneganScanNumber: 1148
Score greater than 27 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.8       1.8        12.5        R.FGPDTSLK.T
 13.2       6.4        15.7        R.QGPAAGHAR.S
 13.0       6.7        1183        -.XDSRATK.V
 12.9       6.8        1183        R.YRQDPGK.G
 12.2         8        17.2        K.SSKSSQLQ.-
 12.0       8.4        1170        -.MGMKVPGK.G
 11.5       9.5        1170        -.MGMKVPGK.G
 10.4        12        12.6        K.ALEEAGFK.M
 10.3        13        17.2        R.GKDAASSTK.V
  9.6        15        1183        K.GQDIFQR.S
Top scoring peptide matches to query 535
Elution from: 21.12 to 25.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1914648.4 FinneganScanNumber: 1147
Score greater than 29 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.6       2.3        15.7        R.QGPAAGHAR.S
 15.3       3.9        12.6        K.ALEEAGFK.M
 12.8         7        12.6        K.ALEAEFGK.Y
 12.4       7.7      -13.44        R.EGIRYAR.I
 12.0       8.4       -0.45        K.EGALTAFR.K
 11.8       8.8        1183        K.GQDIFQR.S
 11.0        11        17.2        R.QSAEKSSK.K
 10.8        11       -0.43        R.ADIYNLR.S
 10.8        11        11.0        -.XNNKFR.R
 10.3        12        1183        K.QEGVGAFR.E
Top scoring peptide matches to query 536
Elution from: 24.24 to 28.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3958389.3 FinneganScanNumber: 1425
Score greater than 21 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.5       6.7        11.4        K.RGFGSGKR.E
 11.5       6.7        11.4        R.RVYDRR.Y
 11.4       6.7        11.5        K.RNYGAKR.G
  7.9        15        1178        R.QALAGTFR.D
  5.4        27        8.30        R.VSGVVEFK.D
  5.1        29        12.0        R.VMAKIMR.E
  5.0        30      -17.68        K.RYIASVR.K
  4.7        32        1175        K.KLTAMQR.Q
  4.4        34        1175        M.QIKTAMR.C
  4.3        34        6.78        M.RLSWFR.V
Top scoring peptide matches to query 537
Elution from: 24.51 to 28.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2620788.8 FinneganScanNumber: 1459
Score greater than 21 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9        12        1167        K.SVDSSIKK.E
  7.9        15      -17.46        R.VTVVGPHR.A
  5.5        26      -17.40        K.GAAPAPPRK.T
  5.1        28       -8.30        R.LSTLMKR.G
  5.1        28       -8.32        R.VTTLMKR.L
  5.0        28        1166        R.GKFAERR.V
  4.3        33       -8.30        K.SITMLRK.K
  3.0        45       -4.42        R.RFDVSIK.L
  2.8        48      -17.40        R.REPLPPR.R
  2.5        50        11.7        R.RIHADPR.R
Top scoring peptide matches to query 538
Elution from: 36.59 to 40.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1247806.8 FinneganScanNumber: 2693
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.7        12        1161        K.TMSIKER.L
  8.8        14        1144        K.KPFMVSR.I
  8.5        15        8.61        K.ASKMLSGR.E
  8.5        15        17.2        R.SATSSTRR.R
  8.2        16        1144        K.GMLIQFR.D
  8.1        17      -11.92        K.SSKKSSNK.K
  8.0        17       -4.38        -.MKSSRTR.H
  7.9        18        1177        -.MKRNGSR.N
  7.8        18        1165        R.DVYAGLAR.G
  7.5        19       -0.50        R.AFQSTRR.G
Top scoring peptide matches to query 539
Elution from: 36.67 to 40.67 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1247806.8 FinneganScanNumber: 2708
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.4        16       -0.50        R.GPASXLQR.R
  7.5        19        1178        K.XASEGPLK.S
  4.8        36        1147        R.WGLGLYR.Q
  2.4        63        8.59        R.RQSMTVK.K
  2.1        66        1160        R.ISPWSFK.A
  1.0        87        1174        K.VASEALMK.Y
  0.6        94        1148        R.AKSQKMR.E
  0.6        94       -5.16        R.GATWKFR.S
  0.6        94        1144        K.GMLIQFR.D
  0.6        94        1177        -.XNNKFR.R
Top scoring peptide matches to query 540
Elution from: 24.32 to 28.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1458955.1 FinneganScanNumber: 1438
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.1       1.9        1174        K.GKSGGRFR.L
 13.0       3.9        1158        K.GDPLLPPR.L
 12.3       4.5        1145        R.RDLVHPK.A
 12.0       4.9        1145        R.SALIPHAR.S
 10.8       6.4        1174        R.RIHADPR.R
  8.5        11        1158        R.KTYVTPR.R
  8.4        11        18.7        K.GITNLGYK.V
  7.0        15        1170        K.WTVRFR.E
  5.3        23        1174        R.DAPRLHR.M
  5.1        23        17.1        -.XGPRPPR.V
Top scoring peptide matches to query 541
Elution from: 24.51 to 28.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 939026.7 FinneganScanNumber: 1460
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.6         3        1176        R.RIHADPR.R
  9.5       7.6        1147        R.RDLVHPK.A
  9.5       7.6        1147        K.RDPLHVK.I
  4.8        23        1176        K.RNYGAKR.G
  2.5        38        1176        R.RFTERR.A
  1.3        51        1147        K.REYKLR.K
  1.1        52        1169        K.SSVAILMK.N
Top scoring peptide matches to query 542
Elution from: 16.66 to 20.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 554897.6 FinneganScanNumber: 849
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.5         2        16.0        K.VMDMVQK.F
 14.5       3.2        16.1        K.QIMSMEK.T
 13.7       3.8       -4.45        K.KMSLEDK.E
 12.1       5.4      -13.53        K.KSEAEFR.D
 11.7         6        11.6        R.SNXSRQK.G
 11.0       7.1        16.0        K.VMDMVQK.F
 10.4       8.1        6.94        R.FGCQVAGK.K
  9.8       9.2        20.0        K.KEWEMK.A
  9.5       9.9       -6.00        K.QMREFR.G
  8.8        12        1163        R.QTGREMK.V
Top scoring peptide matches to query 543
Elution from: 26.39 to 30.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11263195.5 FinneganScanNumber: 1647
Score greater than 15 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5        12      -12.34        K.RDLLPPR.T
  1.8        28        0.62        K.VIDPVAPR.Y
  0.5        38        1152        R.IVTTYIR.E
Top scoring peptide matches to query 544
Elution from: 26.39 to 30.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11263195.5 FinneganScanNumber: 1646
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.3        13        1155        R.RRSPPPR.R
  3.7        18        1168        M.HREPAKK.K
  1.1        33        16.7        R.VAGPGPRGR.E
  0.3        39        12.1        R.FLQRFR.S
  0.3        39        12.1        R.LFQRFR.Q
  0.3        39        8.19        R.MLKRFR.Q
Top scoring peptide matches to query 545
Elution from: 26.39 to 30.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11263195.5 FinneganScanNumber: 1645
Score greater than 14 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.7        29        1168        K.QSHKPLR.S
  1.5        30        1152        R.KAASYVVK.T
  0.7        36        1152        R.LLSYITR.V
  0.7        36        16.7        R.VAGPGPRGR.E
Top scoring peptide matches to query 546
Elution from: 35.38 to 39.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10942299.2 FinneganScanNumber: 2489
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 12.4       2.9      -16.33                    K.LAPPTTIR.S
  8.5       7.3       -0.27                    K.NPRTKPR.T
  8.4       7.4       -0.31                    R.LRGGGGVPR.K
  8.3       7.5       -4.94    9   IPI00029446 R.VPRPFPR.L
  7.8       8.6        1161                    R.SSPHKKAL.-
  7.5         9        1148                    R.APLAPSRR.K
  7.3       9.5       -0.29                    R.HVRSTLR.K
  5.6        14        1148                    -.XAGTPRPR.L
  5.6        14        1148                    -.XAGTPRPR.L
  5.0        16      -16.33                    K.LSPVISPR.N
Top scoring peptide matches to query 547
Elution from: 35.41 to 39.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10942299.2 FinneganScanNumber: 2494
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
  9.9       5.2        1144                    R.ILRYFR.F
  8.2       7.8        1148                    K.ATVRAPPR.R
  5.7        14      -16.32                    K.LSPVISPR.N
  4.5        18       -0.30                    R.GQGRVPVR.E
  2.0        32        1161                    R.IPINPASR.Q
  2.0        33        1161                    R.SYKVKSR.N
  1.4        37        1161                    R.LGASVPAPR.G
  1.1        40        1148                    K.KPPAGNKR.G
  1.0        40       -4.92    9   IPI00029446 R.VPRPFPR.L
  0.7        44        4.17                    -.LNMIHLK.K
Top scoring peptide matches to query 548
Elution from: 35.47 to 39.46 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10942299.2 FinneganScanNumber: 2502
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
  7.7       8.6      -13.22                    K.IGGRGRPR.Q
  7.3       9.5       -4.92    9   IPI00029446 R.VPRPFPR.L
  7.2       9.7        1148                    -.XAGTPRPR.L
  7.2       9.7        1148                    -.XAGTPRPR.L
  7.2       9.7       -0.29                    R.LRGGGGVPR.K
  6.8        11      -16.31                    K.LAPPTTIR.S
  6.8        11        12.7                    R.GGPGKLSPR.K
  6.5        12      -16.31                    K.LSPVISPR.N
  5.4        15        1148                    K.ATVRAPPR.R
  5.4        15        12.7                    K.VHESIKR.S
Top scoring peptide matches to query 549
Elution from: 27.90 to 31.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 29443928.7 FinneganScanNumber: 1787
Score greater than 28 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 19.4      0.48        0.08                    K.LSPVISPR.N
 14.7       1.4        0.08                    K.VISSPPLR.L
 14.6       1.5      -12.86                    M.PVQKQIR.A
 14.1       1.6        3.18                    R.GRRLGGPR.D
 13.2         2        0.08                    K.SSVPLPLR.E
 13.0       2.1        0.10                    R.APELALVR.F
 12.1       2.6        11.5    9   IPI00029446 R.VPRPFPR.L
 11.5       2.9        0.10                    K.LALPADIR.A
 11.2       3.2      -12.86                    R.VEVRLPR.D
 11.2       3.2      -12.86                    R.VXQKIPR.G
Top scoring peptide matches to query 550
Elution from: 27.92 to 31.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 29443928.7 FinneganScanNumber: 1791
Score greater than 24 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 15.6       1.1        0.08                    K.LSPVISPR.N
 11.0       3.3        0.08                    K.VISSPPLR.L
 10.1         4      -12.85                    K.IRNVAAPK.D
  6.3       9.8        1169                    K.VAKKYMK.S
  5.2        13        0.08                    R.TPTPLALR.Y
  2.5        23        16.1                    R.LRGGGGVPR.K
  2.3        25        11.5    9   IPI00029446 R.VPRPFPR.L
  2.0        26        0.10                    R.APELALVR.F
  1.8        28      -12.86                    M.PVQKQIR.A
  1.5        29       -8.43                    R.LPPGIMIK.L
Top scoring peptide matches to query 551
Elution from: 27.58 to 31.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 29443928.7 FinneganScanNumber: 1757
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       2.6        0.12        R.APELALVR.F
  8.8       5.5        1165        K.APASRPLR.Q
  8.4       6.1        1149        K.VPAKVPEK.K
  7.5       7.4        0.10        K.LSPVISPR.N
  6.9       8.5      -12.82        K.HKKSLQK.L
  6.9       8.5        16.2        K.HQKAKTR.H
  6.9       8.5        16.1        R.VHRTVTR.E
  6.1        10      -12.84        M.PVQKQIR.A
  1.8        27        0.12        K.LALPADIR.A
  1.6        29        1165        K.KPPAGNKR.G
Top scoring peptide matches to query 552
Elution from: 24.08 to 28.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5104341.6 FinneganScanNumber: 1407
Score greater than 15 indicates homology
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.9       7.2        9.89        K.MVKLLHK.S
  3.9       7.2        18.4        K.TITRLHK.A
  2.1        11        5.47        R.LAKARGPR.S
  0.4        16        1167        R.ISVKHVGK.L
  0.0        18        18.4        K.ALGQRPVK.T
Top scoring peptide matches to query 553
Elution from: 22.97 to 26.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5812550.8 FinneganScanNumber: 1324
Score greater than 14 indicates homology
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.8       9.2        1167        R.ISVKHVGK.L
  1.3        13        1138        R.VVGLVVGPK.G
  0.8        15        1167        K.VGVNPLLR.L
Top scoring peptide matches to query 554
Elution from: 22.83 to 26.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5812550.8 FinneganScanNumber: 1312
Score greater than 17 indicates homology
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.9       3.6        1138        R.VVGLVVGPK.G
  4.0         7        1154        R.VPLLRNR.H
  2.7       9.5        1154        R.TPLPRKR.Q
  2.5       9.9        1141        K.VRARLPR.F
  2.5       9.9        1154        K.AAALRPLR.L
  2.1        11        18.5        R.VEVRLPR.D
  0.8        15        18.5        R.VPLQQKR.D
  0.7        15        5.56        R.LAKARGPR.S
  0.4        16        1167        R.ASLPVKPR.A
Top scoring peptide matches to query 555
Elution from: 32.48 to 36.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22603013.2 FinneganScanNumber: 2172
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.9         6       -0.30        R.SPIRGSPR.R
  5.3        17        1176        K.GPAAGPRSR.A
  2.6        32        1147        K.ILANGGAPR.K
  2.4        34       -0.32        M.GQIGGKGPR.K
Top scoring peptide matches to query 556
Elution from: 34.30 to 38.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 25198527.0 FinneganScanNumber: 2346
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.0        30       -0.18        -.PVRSSAPR.R
  2.0        37        7.34        -.MGRPRPR.A
  1.3        43        1176        -.XAGTPRPR.L
  1.2        45        1147        R.HGSVSLLR.H
Top scoring peptide matches to query 557
Elution from: 34.36 to 38.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26222762.9 FinneganScanNumber: 2355
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.0        18       -0.17        -.PVRSSAPR.R
  1.9        37        1147        R.RDPKPGAK.R
  1.9        38        1147        R.HGSVSLLR.H
  1.8        39        1160        R.TPEVGIPR.C
Top scoring peptide matches to query 558
Elution from: 34.43 to 38.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26913231.1 FinneganScanNumber: 2362
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2       8.9        1147        R.HGSVSLLR.H
  8.1       9.1       -0.17        -.PVRSSAPR.R
  6.2        14        1168        MQHLIAR
  6.0        15        1147        K.HSKVELR.G
  3.6        26       -0.17        R.SPIRGSPR.R
  2.5        33        1176        R.AAGSRPGPR.G
  2.1        36        1176        K.GPAAGPRSR.A
  1.8        39       -4.81        M.PSLHFLR.K
  1.8        39        1147        R.GGPGKLSPR.K
  1.0        46        4.26        R.MEHLVLK.V
Top scoring peptide matches to query 559
Elution from: 33.32 to 37.30 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 23036873.9 FinneganScanNumber: 2254
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.6       3.2       -0.16        -.PVRSSAPR.R
 12.1       3.6        12.8        K.LLPGDGAAR.R
  3.2        28        7.36        -.MGRPRPR.A
  1.4        42        1147        K.ASAITLHR.S
Top scoring peptide matches to query 560
Elution from: 27.58 to 31.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12684201.8 FinneganScanNumber: 1759
Score greater than 27 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.6      0.36        1156        K.LSPVISPR.N
 13.8       1.8        9.01        R.VPQKELR.G
 13.2         2       -3.94        R.GLRGTLPR.S
 11.3       3.1       -3.93        M.ALSRGLPR.E
 11.0       3.3        9.01        R.SNPLAVLR.V
  9.2         5        9.01        K.KTPASLPR.D
  9.2       5.1       -8.56        R.AWKVIPR.K
  9.1       5.2        8.99        K.VASALVPGR.R
  8.4       6.1        1168        R.KAPHFLR.L
  7.5       7.5       -3.93        K.ARGSLIPR.R
Top scoring peptide matches to query 561
Elution from: 22.06 to 26.05 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 246193.1 FinneganScanNumber: 1236
Score greater than 27 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.6       1.5       -0.62        K.SMFEKTK.F
 16.1       1.6        3.26        R.FANYIDK.V
 13.7       2.9       -9.67        R.FAYLSGGR.G
 13.3       3.1        1170        R.EDHGGRAK.A
 13.0       3.4        1136        R.NLFYGQK.N
 12.6       3.7        19.8        R.FALMNMK.L
 11.8       4.5      -13.53        K.MAYVSKR.C
 11.0       5.4        19.8        R.FALMNMK.L
 11.0       5.4      -18.17        K.FANFLMK.V
 10.0       6.8        1165        K.HHYGVEK.A
Top scoring peptide matches to query 562
Elution from: 34.53 to 38.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10262640.5 FinneganScanNumber: 2377
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.9       6.1      -19.40        R.VVQANALR.K
  4.8        19        1155        -.PVRSSAPR.R
  3.9        24        1155        R.SPIRGSPR.R
  3.5        26        1168        K.EVPKGSPR.E
  3.5        26       -8.04        K.VVGRHFR.M
  2.9        31      -19.41        R.VVGAAAVGAR.V
  2.4        34       -6.50        R.VDLATVPR.R
  1.1        46      -19.40        R.KVNASVPR.G
Top scoring peptide matches to query 563
Elution from: 31.25 to 35.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12095187.9 FinneganScanNumber: 2069
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.6       2.4      -13.15        R.VVQANALR.K
 13.3       2.6      -13.17        R.VVGAAAVGAR.V
 12.9       2.9        1162        R.TVPSGRPR.R
 11.8       3.7       -0.22        R.KLPDIER.G
 11.8       3.7       -0.22        K.KLPDLER.L
 11.6       3.9       -1.80        K.VVGRHFR.M
 11.4         4       -0.26        R.VDLATVPR.R
 11.1       4.4        1162        -.PVRSSAPR.R
 11.1       4.4      -17.79        R.QLPLPFR.L
 10.0       5.6        1162        K.NRVVEPR.L
Top scoring peptide matches to query 564
Elution from: 31.64 to 35.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 14686173.4 FinneganScanNumber: 2101
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.3       8.4        1162        -.PVRSSAPR.R
  7.0        11      -13.15        R.QPVKDRK.A
  6.3        13      -17.77        K.KPPPYLR.N
  5.0        18      -17.79        R.QLPLPFR.L
  4.2        21        12.7        R.SSPIEIPK.I
  3.5        25        2.87        R.RARQSPR.N
  2.8        30      -13.15        R.KVNASVPR.G
  1.6        39       -0.24        R.ELGSVPLR.L
  1.3        41      -13.15        R.VVQANALR.K
Top scoring peptide matches to query 565
Elution from: 31.43 to 35.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12113441.8 FinneganScanNumber: 2086
Score greater than 27 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.7       1.9      -13.15        R.VVQANALR.K
 13.8       2.3        15.8        R.GRSGLQPR.V
  9.2       6.8      -13.17        R.VVGAAAVGAR.V
  8.5       7.9       -0.26        R.VDLATVPR.R
  8.1       8.7        1162        R.TVPSGRPR.R
  7.7       9.5        1175        R.SSPKTPPR.R
  6.3        13       -0.27        R.VVDVSVPR.L
  6.0        14      -13.15        R.LREVTPR.W
  5.7        15        7.27        -.MRTPIPR.G
  5.5        16       -1.77        R.RWKAGPR.E
Top scoring peptide matches to query 566
Elution from: 31.35 to 35.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11982739.7 FinneganScanNumber: 2080
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.3       3.3        12.7        K.LLEPALSQ.-
 12.3       3.3      -13.14        NLKPDRK
  9.5       6.3      -13.14        K.RAALAPGSK.G
  8.6       7.7        15.8        K.NSALGPRR.L
  8.4         8      -13.15        R.VVQANALR.K
  8.1       8.7        1170        R.LLGTYFR.V
  7.7       9.6      -13.17        R.VVGAAAVGAR.V
  7.2        11        1149        R.LDRGRPR.G
  7.2        11       -0.22        K.IIKEDPR.C
  6.3        13       -0.22        R.IATAPEIR.G
Top scoring peptide matches to query 567
Elution from: 31.20 to 35.20 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12268267.5 FinneganScanNumber: 2064
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.4        13      -13.17        R.VVGAAAVGAR.V
  6.3        13        15.8        M.KAPRENR.L
  6.0        14      -13.14        K.RAALAPGSK.G
  5.8        15      -13.15        R.SPIVGNKR.N
  5.7        15       -0.24        R.QVPSALAGK.D
  5.4        16      -13.15        R.VVQANALR.K
  4.6        20      -13.14        K.QPSLRAAK.E
  3.8        23        1157        R.SIHFPIR.G
  3.3        26        15.8        R.TVPRQNR.E
  3.0        28        2.87        K.AAGPRSRR.A
Top scoring peptide matches to query 568
Elution from: 34.43 to 38.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6224729.3 FinneganScanNumber: 2362
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.2       9.2        1161        K.SHKTKIR.E
  6.7        10        15.3        R.GAAVRGALR.G
  6.2        12        15.3        R.VVRNNLR.V
  5.4        14        1161        R.RGLALSPR.L
  4.9        16      -13.57        R.KLLVAGNR.I
  4.3        18        1174        R.VPQKELR.G
  4.1        19        15.3        R.RAQGVALR.R
  4.1        19      -13.57        K.QLRNLVK.K
  4.1        19        15.3        R.QRLQLGR.W
  4.1        19      -13.59        K.QVLGGLRK.K
Top scoring peptide matches to query 569
Elution from: 37.07 to 41.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4907468.8 FinneganScanNumber: 2774
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.6       6.6        10.8        K.HAKVLFR.A
  4.6        17      -13.54        R.VVVERLR.K
  4.0        19       -0.61        K.ALLEVLGR.L
  3.5        22        15.4        R.GAAVRGALR.G
  3.3        22       -0.61        K.QALSPKVK.A
  0.7        41        1174        R.TPPRASLK.R
Top scoring peptide matches to query 570
Elution from: 32.62 to 36.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8477952.7 FinneganScanNumber: 2184
Score greater than 23 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 11.6       3.4      -13.52                    K.QVLGGLRK.K
  9.5       5.4        15.4                    R.GAAVRGALR.G
  4.5        17       -0.59                    K.QALSPKVK.A
  1.5        34      -13.50                    R.KLLVAGNR.I
  1.5        34       -0.61   17   IPI00014424 K.QLIVGVNK.M
  1.4        35        1174                    R.TPPRASLK.R
  1.4        35        1174                    R.VPQKELR.G
  0.9        39      -13.49                    R.KPSIKAAR.A
  0.6        42      -13.49                    R.AQLAARLK.L
  0.4        44      -13.52                    K.KVVQQLR.L
Top scoring peptide matches to query 571
Elution from: 30.93 to 34.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12234607.6 FinneganScanNumber: 2034
Score greater than 28 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.4      0.87        1174        R.VPQKELR.G
 14.7       1.6       -0.58        K.TVVPKAQK.E
 13.9         2      -13.49        K.QVLGGLRK.K
 11.8       3.2       -0.56        K.GAIEVLIR.E
 10.3       4.5        1145        K.VVLQPVSK.I
  9.8         5      -13.49        R.RGALGAVVK.V
  9.5       5.4      -13.49        R.VGIQGRLK.A
  8.8       6.4        1174        K.SGGIPALVR.M
  8.0       7.7      -13.46        M.ARLILER.F
  8.0       7.7       -0.56        K.ILQVLER.N
Top scoring peptide matches to query 572
Elution from: 30.93 to 34.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12234607.6 FinneganScanNumber: 2036
Score greater than 26 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 19.6      0.53        15.5                    R.GAAVRGALR.G
 12.8       2.5        1174                    R.LLPGADRK.R
 10.9       3.9       -0.54                    K.QALSPKVK.A
  9.7       5.2      -13.48                    K.LKGVVAGAR.S
  9.2       5.8        15.5                    QALNRLR
  8.6       6.7       -0.54                    K.ILQVLER.N
  6.9       9.7        15.5                    R.QKSVPRR.G
  6.9       9.8        1161                    R.LLPRSQR.Q
  6.5        11       -0.56   17   IPI00014424 K.QLIVGVNK.M
  5.8        13      -18.09                    K.IPLPRFK.L
Top scoring peptide matches to query 573
Elution from: 38.41 to 42.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4825142.5 FinneganScanNumber: 2975
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.5       5.4        1174        R.VPQKELR.G
  8.2       7.3      -13.36        K.IALREIR.M
  8.2       7.3      -13.40        K.QVLGGLRK.K
  7.4       8.8        15.5        K.VAKRGPSR.D
  6.5        11        1161        R.RLERPAK.D
  4.7        16       -0.48        R.VLTAPTLR.A
  4.2        18      -13.36        K.ARAQLLAK.G
  3.7        20      -13.40        R.VVVERLR.K
  3.6        21       -0.46        R.SPLTLALR.V
  3.6        21       -0.48        R.IPTQVGKK.A
Top scoring peptide matches to query 574
Elution from: 24.88 to 28.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 253994930.6 FinneganScanNumber: 1510
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1        10        18.4        R.QRLQLGR.W
  5.5        12        18.4        R.QRGQLLR.H
  5.4        12        18.4        K.QGRAGLIR.G
  5.4        12        18.4        K.QGRQLLR.Q
  5.2        12      -10.51        R.KNVLQLR.L
  5.0        13      -10.53        K.QVLGGLRK.K
  4.8        14      -15.16        K.VVKFLHK.V
  1.5        30      -10.53        R.VGIQGRLK.A
  0.8        34        18.4        K.QRQLLGR.L
Top scoring peptide matches to query 575
Elution from: 25.01 to 28.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 253994930.6 FinneganScanNumber: 1522
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.3       3.9      -15.16        K.VVKFLHK.V
  9.1       5.1      -10.53        R.VVVERLR.K
  9.1       5.1      -10.53        K.QVLGGLRK.K
  8.8       5.5        18.4        K.VAKRGPSR.D
  8.6       5.7        18.4        K.GRKGSIPR.T
  5.2        12        18.4        R.GAAVRGALR.G
  5.0        13      -10.51        K.QLRNLVK.K
  5.0        13        1164        R.GLRGTLPR.S
  4.5        15      -10.53        K.VVQLQRK.I
  4.1        16        18.4        R.RATKAAPR.A
Top scoring peptide matches to query 576
Elution from: 25.10 to 29.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 253994930.6 FinneganScanNumber: 1535
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.9        11        1135        R.LGKPSLVR.E
  4.5        15        1164        R.RLSLGAPR.V
  4.5        15        1164        R.RLSLQPR.S
  4.2        16        1164        M.ALSRGLPR.E
  3.7        18        1164        R.RGLALSPR.L
  3.6        18      -10.53        R.VVVERLR.K
  2.9        21        2.41        K.LSLITAPR.R
  2.5        23      -15.16        K.VVKFLHK.V
  2.5        23        1148        R.KIGPLVDK.Q
  2.5        24        2.39        K.TVVPKAQK.E
Top scoring peptide matches to query 577
Elution from: 24.90 to 28.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 253857331.1 FinneganScanNumber: 1512
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.0      0.83        18.4        R.GAAVRGALR.G
  8.0       6.6      -10.51        K.QRPTKLK.S
  7.9       6.7        18.4        R.QRGQLLR.H
  7.9       6.7        18.4        R.QRLQLGR.W
  7.9       6.7        18.4        K.QRQLLGR.L
  6.6         9        18.4        K.VAKRGPSR.D
  6.4       9.5        2.41        K.QALSPKVK.A
  6.3       9.6        18.4        QALNRLR
  5.5        12      -10.53        K.QVLGGLRK.K
  5.4        12      -10.49        K.ERLLAIR.R
Top scoring peptide matches to query 578
Elution from: 35.95 to 39.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2135162.8 FinneganScanNumber: 2583
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.2       6.4        7.50        R.ELGLVKGR.S
 10.2       6.4        7.52        K.KSLALSPR.L
 10.1       6.5        7.52        K.RAISPSIK.E
 10.1       6.6        7.50        M.AGTGLLALR.T
  9.8       6.9        7.54        R.KAAIEIAR.L
  8.5       9.4       -5.38        R.EAVRRLK.S
  8.3       9.8       -5.38        R.KALDRLR.K
  8.1        10        7.52        R.NLVERLK.S
  7.6        11       -5.38        K.KRVEAIR.G
  7.5        12      -10.02        R.KIVLWGR.T
Top scoring peptide matches to query 579
Elution from: 41.66 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 702275.5 FinneganScanNumber: 3225
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.2        11        1133        K.YYDALVK.A
  7.2        11        1162        K.YYDLAAR.L
  7.2        11        1149        R.YYNKQR.V
Top scoring peptide matches to query 580
Elution from: 36.72 to 40.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2660661.3 FinneganScanNumber: 2714
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.0       7.8        12.4        K.KARAGEIK.G
  8.7        13       -3.61        K.LEALLSVK.Q
  7.0        20        1169        R.DQAIALLK.D
  7.0        20        1169        K.EISPAVKK.N
  7.0        20        1172        K.KNQGLRR.E
  7.0        20        1172        R.SRSPIRR.R
  7.0        20        1172        R.SRSPLRR.S
  5.5        27        12.4        K.QALSAKVR.T
  4.8        32        12.4        R.KAEARVAK.I
  4.7        34        12.4        K.KARQEIK.K
Top scoring peptide matches to query 581
Elution from: 36.67 to 40.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2660661.3 FinneganScanNumber: 2705
Score greater than 23 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.7       8.5        1143        R.EALRKVR.D
  9.6        11        1156        M.AGTGLLALR.T
  8.0        16        1156        R.QANLLKGK.Q
  5.9        25        12.4        K.QALSAKVR.T
  5.9        25        1172        R.AQRAARAK.Q
  5.8        26        12.4        K.KARAGEIK.G
  5.8        26        12.4        R.KAEARVAK.I
  5.6        27        12.4        R.VLLESRR.K
  5.5        27      -16.49        R.LSSIILAR.E
  4.3        36        1156        K.EVKVAAVR.D
Top scoring peptide matches to query 582
Elution from: 41.66 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 83745.1 FinneganScanNumber: 3226
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 583
Elution from: 25.25 to 29.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1658739.1 FinneganScanNumber: 1551
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.2      0.54       -7.35        K.EATPAKEK.H
 16.1       2.2        1151        R.GAGSQSLPR.G
 15.9       2.3        1135        K.EATVPDLK.R
 14.1       3.5        1151        R.SGGPSSPKR.L
 12.1       5.5        8.54        R.AGAGQTVGGR.A
 11.9       5.8        1133        -.GAAVGVWGR.L
 11.0         7        8.56        R.QQGSVAGAR.A
 10.4       8.2        1151        K.EAAQLQGR.K
  8.6        12       -4.29        R.QRDRGNK.S
  8.5        13       -7.41        R.ADLDGVGVK.A
Top scoring peptide matches to query 584
Elution from: 36.20 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1480438.8 FinneganScanNumber: 2623
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.3       3.4        1.50        K.KMYIFR.G
 15.3       3.4        1.50        K.KMYLRF.-
 14.4       4.1        1.49        -.XPPMPFR.K
 14.4       4.1        1.49        -.XPPMPFR.K
  9.8        12        9.97        K.THLEAFR.R
  8.4        16      -14.24        M.KAVNEQGK.E
  7.9        19        1.73        K.EAGRERR.A
  7.7        19        1139        -.GAAVGVWGR.L
  7.1        22        1152        R.QPPIDFR.D
  6.8        24      -14.25        R.QGDTAILR.C
Top scoring peptide matches to query 585
Elution from: 18.38 to 22.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 414672.7 FinneganScanNumber: 951
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 22.1      0.63        1132                    -.MAAATASPR.S
 14.6       3.6        1128                    -.MAIEHFK.M
 14.2       3.9       -1.47                    MAVPMPSK
 13.3       4.8       -5.86    4   IPI00152453 -.MAVQGSQR.R
 12.6       5.6        1132                    -.MAAVGAEAR.G
 12.6       5.6        1132                    -.MEGQVVGR.V
 12.6       5.7        6.99                    K.MDRTPEK.D
 12.5       5.7        1157                    -.MAHYPTR.L
 10.4       9.3      -18.67                    K.QMSGARAR.A
 10.2       9.7        15.4                    R.NTNDREK.N
Top scoring peptide matches to query 586
Elution from: 25.08 to 29.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1330070.4 FinneganScanNumber: 1532
Score greater than 29 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 23.0      0.49        1145        R.QLSKAAMK.E
 21.9      0.63        1166        R.KADSSLQK.S
 15.1         3      -17.15        K.GVLEGFKK.N
 14.2       3.7        1166        K.DSTKVAGAK.R
 13.9       3.9        0.28        K.ESLKATTK.T
 12.2       5.8        1160        K.TGRMRQK.A
 11.2       7.4        1145        -.MRALLEK.L
 11.1       7.4        1148        R.VLPHPGEK.T
 10.7       8.3        1144        R.FFPPLQK.Q
  9.6        11        1166        K.QLSNSISK.C
Top scoring peptide matches to query 587
Elution from: 24.83 to 28.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2431011.1 FinneganScanNumber: 1504
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.3       1.4        1132        K.GVLEGFKK.N
 13.0       3.7        1157        R.RDALKMK.L
 11.8       4.9        13.7        K.LQSKTSSK.V
 10.9       5.9        1161        K.RQGLFEK.H
  9.9       7.4        1132        K.ILNVYQK.D
  9.7       7.8        12.2        K.RNHVGPAK.A
  9.5       8.3        1161        R.NGTLVAFR.G
  9.2       8.9       -7.48        K.IKQSMKK.D
  8.5        10        1157        R.RTSLCLK.G
  8.4        11        1156        R.FHVTVFK.F
Top scoring peptide matches to query 588
Elution from: 25.25 to 29.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2431011.1 FinneganScanNumber: 1550
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        15        1162        -.MSRVLQK.D
  5.7        18        1133        K.VKVMKEK.G
  5.3        19        1149        K.LRGMRXK.D
  4.6        23        1133        R.AMTGLIKK.H
  3.3        31        1133        K.VKVKMEK.K
Top scoring peptide matches to query 589
Elution from: 36.96 to 40.96 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2528260.2 FinneganScanNumber: 2756
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.5        11        8.71        K.CSSSVAIR.E
  5.0        33      -19.88        R.EEAKKMK.T
  4.2        39      -19.90        R.KAAESMVK.F
  3.8        43        1143        K.VQGMNVSK.L
  1.3        76      -16.09        R.VYGQPSTK.H
  0.6        89        1138        R.AMIFDGPK.V
  0.5        92        1163        K.QLAQCMK.I
  0.5        93        16.1        -.MTGRVCR.G
  0.3        97        1.29        R.QLSESSTK.D
Top scoring peptide matches to query 590
Elution from: 36.91 to 40.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2528260.2 FinneganScanNumber: 2750
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.8       2.7        1130        -.MSGIGNKR.A
 11.0       8.2      -19.89        K.MKTENLK.K
  9.3        12        1135        -.MMPGVTVK.D
  8.0        16        1136        K.EDVLSTSK.D
  7.9        17        1135        -.MMPGVTVK.D
  7.8        17        1143        -.MGSELIGR.L
  7.6        18        1138        R.FMGDAPLK.G
  7.6        18        16.2        -.MVRASCR.L
  7.2        20      -19.89        K.EVKAAMSK.L
  7.1        20        4.13        -.MWLGTSGK.S
Top scoring peptide matches to query 591
Elution from: 24.85 to 28.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1516272.0 FinneganScanNumber: 1507
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.6       7.8        1156        K.EHRIAPR.V
  9.1         9        1156        R.DRYLRR.L
  8.4        10        5.78        R.DRFKVSK.K
  6.3        17       -7.00        R.TQPLKHR.V
  6.2        18       -7.00        R.TKQIHPR.N
  5.4        21        1140        K.RYDAILK.R
  4.6        25        1135        R.MRFIRR.I
  4.6        25       -6.99        R.RYGKLSR.H
  4.5        26        1149        R.IALSMSLK.N
  4.4        26       -7.00        R.RGPPSPLR.G
Top scoring peptide matches to query 592
Elution from: 24.32 to 28.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1315158.5 FinneganScanNumber: 1439
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.9       7.4       -0.36        -.MAASGKTSK.S
 10.6        10        1144        -.MFGPAKGR.H
 10.5        10        1161        -.MTRGSPSK.I
 10.5        10        3.44        VSDFGLSR
  9.7        12        1136        K.GQYDVAVK.M
  9.7        12        1161        K.GKACTNTK.C
  9.7        12        16.2        K.LTSDYGPK.A
  9.6        13        1153        -.MGMKVPGK.G
  9.6        13        1136        R.FQTDAVAK.F
  9.5        13        1161        R.EGDRKMK.N
Top scoring peptide matches to query 593
Elution from: 24.38 to 28.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1315158.5 FinneganScanNumber: 1449
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.5       3.2        1157        -.MWLGTSGK.S
 13.5       5.2        1124        R.AASTFNIR.F
 11.5       8.1        1133        R.LSAMEKGK.L
 10.5        10        12.4        R.EVSMGLTK.S
 10.0        12        1133        K.KVTEMAGK.T
  9.7        12       -0.37        R.VSQSMKGK.S
  9.6        13        3.46        R.EVSDRFK.L
  9.4        13        1124        K.KSASSFPR.S
  8.9        15        19.8        R.GMGLSLMR.L
  8.3        17        1136        R.QVFGEATK.Q
Top scoring peptide matches to query 594
Elution from: 27.22 to 31.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 587144.8 FinneganScanNumber: 1730
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.0        11       -0.58        R.GLPGVEGPR.G
  7.6        12       -0.55        R.AGPALPEAR.F
  6.8        15        1123        K.VIIFGMGK.R
  5.5        20       -0.56        R.LRGYSTGK.T
  2.7        38        15.8        K.TMKSKMR.E
Top scoring peptide matches to query 595
Elution from: 32.00 to 35.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1036762.9 FinneganScanNumber: 2133
Score greater than 26 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.0         1       -0.52        M.LLPSLSPR.V
 14.7       1.1       -0.54        K.LPVDILGR.V
 12.4       1.9      -13.26        R.LLRDLPR.L
  8.3       4.9        2.53        R.LPRGAGRR.L
  6.7       7.1      -13.26        K.KKGPSLPR.G
  5.5       9.2        19.6        K.MKPIIHK.S
  4.6        11       -0.54        K.LPLDVLGR.V
  4.6        11       -0.50        R.LPLEAALR.C
  4.5        12        1158        M.AALPGTVPR.M
  4.4        12        1158        R.ELITLHR.K
Top scoring peptide matches to query 596
Elution from: 31.88 to 35.88 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1036762.9 FinneganScanNumber: 2127
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8       3.5        1125        K.IVVLFYK.A
  9.7       3.5        19.6        K.MKPIIHK.S
  4.7        11       -5.11        R.LTKVFFK.I
  4.6        11        1158        K.AAPAPKAQK.G
  3.7        14       -5.07        K.ALKFLYK.R
  1.9        21        15.3        K.IPNGRLGR.G
  1.9        21       -8.90        K.LPIPMIAK.N
  1.9        21      -13.26        R.LPKQQLR.K
  1.9        21       -0.54        K.LPLDVLGR.V
  1.9        21       -0.50        R.LPLEAALR.C
Top scoring peptide matches to query 597
Elution from: 25.27 to 29.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7350057.8 FinneganScanNumber: 1553
Score greater than 21 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8         2        17.5        R.VPVRNLGK.V
  7.6       2.7        1148        R.SAPPLLKR.K
  3.6       6.7        17.5        K.RELPVLR.D
  2.7       8.3        1148        R.GVGVLPALR.M
  2.7       8.3        1156        K.IVVLFYK.A
  1.9       9.9        4.78        R.VLRPRNK.R
  1.1        12        1135        K.VLPQRIR.E
  1.1        12        1148        K.VLQGLVPR.G
  1.1        12        1.70        K.VLVVEPVK.-
  0.6        13        1135        R.RPLLVQR.Y
Top scoring peptide matches to query 598
Elution from: 25.29 to 29.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7350057.8 FinneganScanNumber: 1555
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.6       3.4        4.78        R.VLRPRNK.R
  3.9       6.3        1135        K.VLPQRIR.E
  3.9       6.3        1148        K.VLQGLVPR.G
  3.9       6.3        1.70        K.VLVVEPVK.-
  1.1        12        1135        K.RHXKLLK.Q
  0.9        12        1148        R.GVGVLPALR.M
  0.8        13        1156        K.IVVLFYK.A
Top scoring peptide matches to query 599
Elution from: 24.81 to 28.81 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4666686.6 FinneganScanNumber: 1501
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.2         4       -0.33        K.QQGPILTK.H
  9.1       6.4        2.72        K.TGRPARAR.L
  7.5       9.3      -13.04        R.QVSKGLPR.R
  6.2        12       -0.33        K.AAPGDVKVK.E
  5.8        14        1130        R.RRGELPR.D
  4.1        20        1156        K.QEAGLIPR.T
  4.0        21        1156        R.DAKISPPR.S
  1.9        34        12.4        K.LVIDEPAK.E
  1.6        37        2.71        R.GVPSRRGR.G
  1.6        37      -13.01        M.AAAVAAALAR.L
Top scoring peptide matches to query 600
Elution from: 24.63 to 28.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4666686.6 FinneganScanNumber: 1480
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       3.2        1130        R.RRGELPR.D
  8.4       7.6        1130        K.RRPDALR.M
  7.8       8.6        1130        R.RRTPPTR.A
  4.2        20        1130        R.RERPGLR.S
  4.1        21        1130        R.RKQQAPR.R
  3.7        23        1143        K.RAAELAPR.D
  2.1        33        2.71        R.GVPSRRGR.G
  1.9        34        1143        R.GDPARLVR.T
  1.9        34       -1.85        R.GHFRIVR.G
  1.7        36      -13.01        M.AAAVAAALAR.L
Top scoring peptide matches to query 601
Elution from: 24.56 to 28.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4666686.6 FinneganScanNumber: 1472
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       3.2       -0.33        K.TLGDLIPR.H
 11.5       3.7        1156        K.QEAGLIPR.T
 10.8       4.4       -0.32        K.LADILSPR.L
  8.1       8.2        15.4        M.SLAGGRAPR.K
  7.6       9.1        1156        K.GISPIXPGR.M
  7.5       9.3        1143        R.SPLSRPAR.L
  6.4        12        1156        R.GLVADPGVR.G
  6.1        13       -0.33        K.ATVVEIPR.K
  5.6        15      -13.04        R.QVSKGLPR.R
  5.2        16        12.4        M.LEDPVALK.A
Top scoring peptide matches to query 602
Elution from: 24.37 to 28.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4666686.6 FinneganScanNumber: 1444
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.0       4.2        1143        R.ALPERAAR.A
 10.9       4.3        1156        K.QILDPAAR.V
 10.9       4.3        1156        K.QEAGLIPR.T
 10.7       4.5        1143        R.AVRLGDPR.V
  9.5       5.9        1143        R.ETPKPRR.K
  9.2       6.4        1156        R.EIGAQPLR.I
  8.8         7        1143        -.PNRILDR.H
  8.2       7.9       -0.31        K.ELPLSAVR.F
  8.1       8.1       -0.31        R.LADLPSIR.F
  7.6       9.1        1156        K.GLLAPEAGR.A
Top scoring peptide matches to query 603
Elution from: 28.11 to 32.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4416928.1 FinneganScanNumber: 1805
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.0       2.6        7.21        -.MRHSLLK.G
 11.2         4       -0.20        K.TLGDLIPR.H
 10.9       4.2       -0.20        K.GAGGALLTPK.T
 10.8       4.4        15.4        K.LAKKMFF.-
  9.9       5.3        19.9        R.LVQHMLK.I
  9.5       5.9        15.6        M.SLAGGRAPR.K
  8.7       7.1       -0.20        R.GLTPKPGSK.S
  8.3       7.8      -12.91        R.KIVTGNPR.C
  8.3       7.8        15.6        K.RRAEPQK.A
  8.0       8.3      -12.87        M.AAAVAAALAR.L
Top scoring peptide matches to query 604
Elution from: 27.70 to 31.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4416928.1 FinneganScanNumber: 1772
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 29.4      0.06       -0.18        K.LADILSPR.L
 20.1      0.52        1143        K.GEIRVGPR.Y
 17.8      0.88       -0.18        R.LADLPSIR.F
 13.4       2.4        15.6        K.GASLARPGR.G
 13.0       2.7        1156        K.DPLKTPGR.L
 12.9       2.7        1156        K.EPAKVSPR.A
 12.7       2.9        1131        K.EGLPRRR.H
 11.8       3.5        1143        R.TLPRSGPR.N
 11.5       3.7        1143        K.SPLRSPAR.L
 11.3       3.9        1143        K.RAAELAPR.D
Top scoring peptide matches to query 605
Elution from: 27.72 to 31.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1660793.0 FinneganScanNumber: 1775
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.5         2      -19.93        R.TVLQLPSK.S
 15.5         2      -19.94        K.VLTPTQVK.N
 15.5         2        16.7        R.VLTYYVK.L
 13.0       3.6        8.52        K.VNPNVKSK.A
 12.9       3.7       -4.18        R.RGVNQALK.H
 12.3       4.2        8.52        K.QKPAVTNK.H
 10.8         6        1151        K.RTGLGAPGR.D
 10.8         6        8.50        M.TTLAGAVPR.M
  9.6         8        8.50        R.LTVVSPNR.A
  9.2       8.8        1151        K.GASLARPGR.G
Top scoring peptide matches to query 606
Elution from: 24.51 to 28.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1841917.0 FinneganScanNumber: 1461
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.2       2.7        1123        R.QVSKGLPR.R
 13.9       2.9       -3.82        R.RGVTPLSR.A
 13.0       3.6        1151        K.RSAQLGPR.S
 12.5         4        8.88        M.TTLAGAVPR.M
 10.8       5.8        8.88        K.IVVSNTPR.T
 10.4       6.4        8.90        R.AALSATVPR.H
  9.0         9        8.90        K.SSLVNIPR.D
  8.9       9.1        1135        ANVEKPVK
  8.8       9.3       -3.82        -.XTRLVSPR.D
  8.6       9.9        7.38        R.FRRGPPR.Q
Top scoring peptide matches to query 607
Elution from: 36.32 to 40.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2207749.8 FinneganScanNumber: 2647
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.4      0.81        1126        R.RGKASLPR.R
 17.5       1.2        1152        K.LADILSPR.L
 15.8       1.9        1152        R.LADLPSIR.F
 14.0       2.8        1152        R.IPTSTPLR.D
 12.6       3.9        1152        K.DTVLAPLR.M
  8.3        11        1142        R.RPGSRRR.S
  6.7        15        1126        M.RSLQKPR.T
  6.0        18        1126        R.VQGVLRGR.A
  5.8        19        1152        R.TSLPTPLR.A
  5.0        23        1139        R.DGKLAKPR.Q
Top scoring peptide matches to query 608
Elution from: 36.34 to 40.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2207749.8 FinneganScanNumber: 2650
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.3       6.6        1139        R.VTGPQKVR.R
  9.2       8.5       -3.30        K.EKGPTLLK.H
  8.8       9.3        12.5        R.RAALQAQK.N
  8.8       9.4        1126        R.GRVAQVVR.T
  8.4        10        1152        R.EEIKPIR.L
  8.4        10        1126        R.EKARKPR.S
  8.4        10        1152        R.GSIEIPLR.D
  8.4        10        1126        R.RTKGPGLR.K
  8.4        10        1155        R.TRRPAQR.L
  8.4        10        1152        K.DTVLAPLR.M
Top scoring peptide matches to query 609
Elution from: 24.63 to 28.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 941630.8 FinneganScanNumber: 1480
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       5.7      -14.29        R.RGEAQGLR.K
 11.6       5.7      -14.29        K.RGQAALDR.L
  9.3       9.8        1139        M.GRAGAGSPGR.R
  9.1        10      -18.86        K.VNTHLFR.H
  8.5        12        1144        R.VLSCPGPR.A
  8.1        13      -14.27        R.AAASSARPR.A
  7.5        15       -1.61        R.AAASSGLPGR.C
  7.5        15        1139        R.RREGPDR.S
  6.9        17        11.1        K.LDSEAVPR.A
  6.9        17        1124        R.SQVEAVPR.S
Top scoring peptide matches to query 610
Elution from: 26.62 to 30.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6580200.0 FinneganScanNumber: 1674
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.2       2.7        1119        R.RRPGPGPR.S
 12.1       4.3       -0.82        R.LGPGSPLPR.R
 10.1       6.8        14.8        R.RHTLGGPR.S
  9.8       7.3        14.8        R.QRHISPR.R
  8.5       9.8        1127        R.RLXPGFR.X
  7.7        12        14.8        R.RRPPDPR.E
  7.0        14        1119        R.RRPNPPR.K
  6.1        17       -0.81        K.KSKEVFR.K
  6.0        17        1119        R.RRNPPPR.T
  6.0        17        14.8        K.RSXQHPR.V
Top scoring peptide matches to query 611
Elution from: 26.61 to 30.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6580200.0 FinneganScanNumber: 1668
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.2       6.5        1144        R.HLPDLAAR.G
  9.9       7.1        14.8        R.QRHISPR.R
  6.6        15        1135        R.AAFMLALR.S
  6.3        16        1127        K.AFWGKKR.I
  5.1        21      -13.39        M.PPLARSPR.A
  4.9        22        1139        K.FWKIGNK.E
  3.9        29        1144        R.YGRILDR.E
  3.2        33        1135        K.FTKMIPR.D
  3.2        33        14.8        R.RHTLGGPR.S
  3.2        33        14.8        R.RRPPDPR.E
Top scoring peptide matches to query 612
Elution from: 26.59 to 30.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6580200.0 FinneganScanNumber: 1667
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3        13        1116        R.SSLLLGFR.R
  6.5        16        14.8        R.RHTLGGPR.S
  6.5        16        14.8        R.RRPPDPR.E
  6.4        16        1119        R.RRPGPGPR.S
  4.8        23        14.8        R.QRHISPR.R
  4.3        25        1135        R.AAFMLALR.S
  3.9        28        1140        K.KKNVTMR.S
  3.7        30        1144        R.YGRILDR.E
  3.2        33        1140        M.TMRSLLR.T
  3.0        34        1119        R.RRNPPPR.T
Top scoring peptide matches to query 613
Elution from: 34.06 to 38.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1870317.1 FinneganScanNumber: 2315
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.3       4.4        15.1        K.QPGRPSPR.T
 12.1       4.7        1143        R.KFSTASPR.R
 11.0         6      -13.01        R.KVSNPPPR.L
  8.4        11       -0.46        K.FSKTVQGK.V
  8.3        11        1122        R.RLCGFLK.S
  7.4        14        1122        K.FRCAVLK.N
  7.1        15        19.4        K.MQLFLAR.Q
  6.9        15        15.1        R.DTHRLPR.A
  6.7        16        12.1        K.ETQIYIK.L
  6.3        18        1111        K.ISGKMTLK.E
Top scoring peptide matches to query 614
Elution from: 24.32 to 28.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1502483.9 FinneganScanNumber: 1440
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.4        22        1138        R.CFQHFR.A
  2.5        34        1103        K.MEQTKNK.F
  1.6        42        13.0        -.XPDPPPGR.V
  0.0        60        1114        K.NGPPPCPR.L
Top scoring peptide matches to query 615
Elution from: 24.30 to 28.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1502483.9 FinneganScanNumber: 1432
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.5       1.4        1.95        R.SSCEVVSK.A
 12.2       3.7        1132        R.SSGQTVCR.C
 10.8       5.1        1127        R.GEFMPASR.S
  9.8       6.5        17.5        R.SSCERTR.H
  7.0        12        1116        K.SSMELPSK.S
  6.9        13       -6.84        K.SSNDFIGR.I
  6.0        15        5.72        K.GDEAGGYVK.V
  5.7        17      -17.90        M.ATSTSTEAK.S
  5.3        18        1107        K.ETFSAPSR.A
  5.0        19      -19.41        R.HSSPTGGPR.G
Top scoring peptide matches to query 616
Elution from: 24.45 to 28.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1502483.9 FinneganScanNumber: 1456
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.6       1.7       -6.84        R.GGPGEPEPR.L
 11.1       4.8        1132        K.SGSMGGKDR.L
 10.1       5.9       -3.33        -.MTGRVCR.G
  9.9       6.2        1132        R.SGMVSSGNR.R
  9.4         7      -19.41        R.GPGASVHDR.N
  8.0       9.6        1127        R.YCIPGER.L
  8.0       9.6       -6.82        K.YINSQXR.S
  7.4        11       -6.82        K.YTLNDNR.L
  7.4        11      -19.38        R.YTNARDR.N
  6.6        13      -15.11        -.MWLGTSGK.S
Top scoring peptide matches to query 617
Elution from: 34.20 to 38.17 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5010369.8 FinneganScanNumber: 2332
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.4       9.4        1111        R.KVSNPPPR.L
  6.5        15      -18.47        K.GLKSSIYK.E
  4.9        21      -11.18        K.KAVMKFR.N
  4.0        26       -2.93        K.HLRGDGLK.D
  1.8        44      -15.46        K.HARVKER.E
  0.3        61        9.61        K.GLGSPTVHK.I
  0.3        61        1136        R.TFTDIGIK.Y
Top scoring peptide matches to query 618
Elution from: 37.54 to 41.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18024308.9 FinneganScanNumber: 2857
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.1         8        11.9        R.GTPPLTPGR.L
  8.0        10        1124        R.VAHRFHK.A
  5.0        20      -13.19        R.TGHGLRVR.F
  4.7        22        1141        M.GPGPSRAPR.A
  4.6        22        1113        K.EIHGAIVR.M
  4.1        25        11.9        R.APSPLGPTR.D
  1.4        46        1129        R.GLHRGAGAR.L
  1.2        49       -5.12        K.FAGRVAFK.L
  1.0        50        19.3        K.AHKKMHK.H
  0.6        55        12.0        K.TAEKRYK.C
Top scoring peptide matches to query 619
Elution from: 35.93 to 39.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18024308.9 FinneganScanNumber: 2579
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.5       7.2        3.72        R.CXKSLLK.T
  6.0        16        12.0        K.EGAAVIAHK.V
  5.8        17        12.0        R.SQIPPTPR.T
  5.1        20       -0.60        R.GPKGVQGPR.G
  4.4        23      -16.10        R.SELKKYK.E
  4.3        24        12.0        R.GTPPLTPGR.L
  3.7        28      -17.62        M.HFAKKHK.K
  2.8        33        12.0        R.APSPLGPTR.D
  2.5        36        1126        K.LHTPNISI.-
  1.3        48        1124        R.VAHRFHK.A
Top scoring peptide matches to query 620
Elution from: 36.01 to 40.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18024308.9 FinneganScanNumber: 2593
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.6       3.5        1124        R.VAHRFHK.A
 10.2       6.1       -0.59        R.GPKGVQGPR.G
  6.8        13      -16.10        K.KLEKSYK.L
  4.4        23      -16.10        R.SELKKYK.E
  4.3        24        1126        R.LTLSFASR.T
  3.8        27        12.0        R.SQIPPTPR.T
  3.6        28        12.0        R.GTPPLTPGR.L
  2.4        37        12.0        K.IIEGGAAHK.D
  2.3        38        1129        R.GLHRGAGAR.L
  2.1        39        1126        K.KLYIDSR.A
Top scoring peptide matches to query 621
Elution from: 36.17 to 40.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18024308.9 FinneganScanNumber: 2619
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.7        22        12.0        R.SQIPPTPR.T
  3.6        28       -0.57        R.RVSPSPPR.A
  2.8        33        1137        K.VPPHAAFR.A
  2.3        38        1138        R.SSLFELAK.K
  1.4        46        1129        R.RPHSKGGR.G
  0.9        52        12.0        R.SPSAPPALR.R
  0.8        54        1113        R.AAVLDHLR.G
  0.7        54        1105        -.MAFLKLR.D
Top scoring peptide matches to query 622
Elution from: 24.30 to 28.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1462205.5 FinneganScanNumber: 1432
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.5       1.4        1128        R.SSCEVVSK.A
  8.4       9.1      -14.78        R.GMQGPPGPR.E
  6.9        13        1119        K.SSNDFIGR.I
  6.0        16        1131        K.GDEAGGYVK.V
  5.8        17       -2.22        R.TMSFPASR.I
  5.7        17        1108        M.ATSTSTEAK.S
  5.0        20        1106        R.HSSPTGGPR.G
  4.9        20        18.6        R.VDFGSSER.L
  4.8        20        1110        K.AFMTAPGGK.K
  4.6        22      -14.80        K.GMHGGVPGGK.Q
Top scoring peptide matches to query 623
Elution from: 37.99 to 41.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 14770719.5 FinneganScanNumber: 2931
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4        12        1131        K.IKMTGTTK.E
  0.7        56        1135        R.LKYESQK.S
  0.5        59        1135        K.KIESFGSK.S
  0.5        59        1105        K.RFQAFVK.K
Top scoring peptide matches to query 624
Elution from: 34.30 to 38.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2250784.2 FinneganScanNumber: 2347
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.7        14        6.27        R.GSLDGFMR.G
Top scoring peptide matches to query 625
Elution from: 26.05 to 30.05 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 554073.7 FinneganScanNumber: 1620
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.2       2.4        1138        R.TAVLSPGPR.L
  6.5        11        15.0        R.TRPGALGAR.G
  6.4        11        1125        K.RLTSPAPR.E
  5.0        16        1138        R.LSAGPSLPR.A
  4.5        17       -0.50        R.VNALASVPK.F
  4.4        18        15.0        K.AQLRSAPR.A
  4.4        18        1125        R.GNTPKKPR.L
  4.0        20        15.0        K.GRPDVAKR.L
  3.6        22        19.3        K.MIIVGPPR.Q
  3.4        23      -13.00        R.GAKKPLER.V
Top scoring peptide matches to query 626
Elution from: 20.74 to 24.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 403679.7 FinneganScanNumber: 1113
Score greater than 24 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       2.3        3.27        K.IMLPGVLR.Y
 10.8       3.1        1122        R.QGLTLLPR.L
 10.2       3.6        1109        R.GTRVPVIR.N
 10.1       3.6       -9.22        R.RLLPMLR.L
  7.0       7.3        11.5        K.IQQQIIR.H
  7.0       7.4      -13.51        -.XGARRGLR.Q
  7.0       7.4        11.5        R.IQIQQLR.G
  7.0       7.4      -13.51        -.XGARRGLR.Q
  6.7       7.8      -13.51        R.RRQVALR.R
  6.7       7.8        11.5        K.GQSPKILR.L
Top scoring peptide matches to query 627
Elution from: 40.77 to 44.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3010687.6 FinneganScanNumber: 3132
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
  6.2        16        19.0                    R.HKRTMVK.T
  5.5        19        1108                    R.KPRGDVVK.V
  5.2        20        1108                    R.KPGDRVVK.L
  1.7        45        1108                    R.GQLLAQLR.N
  1.7        45        1121                    GIISPVGGAK
  1.5        47        11.7   19   IPI00642952 R.GAVVGLDLR.M
  1.0        53        1108                    R.LQQLALGR.L
  0.8        56      -16.27                    K.DKPVLSLK.T
  0.6        58        1121                    K.KADPAAVVK.R
  0.5        59        1133                    K.EILPEAVK.D
Top scoring peptide matches to query 628
Elution from: 36.89 to 40.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11509744.8 FinneganScanNumber: 2741
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.2        20        1133        K.KLEDIALP.-
  4.4        24        1133        K.EPLVEALK.V
  3.0        33       -0.63        R.KPQDKKR.Q
  2.9        34       -0.62        K.QRALAAAAK.K
  2.8        35      -16.14        K.KVLDIPSK.Y
  2.7        35        1108        R.EPLKGRAK.T
  2.6        37        1121        R.KPQSLKTP.-
  2.4        38        1108        R.RVKSPSPK.S
  1.1        52      -16.14        K.VQLIDALK.E
  1.0        53        7.37        K.KKTTFFK.R
Top scoring peptide matches to query 629
Elution from: 36.90 to 40.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11509744.8 FinneganScanNumber: 2747
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8       8.7        11.9        -.XVPLAEKR.R
  4.4        24       -0.65        K.GLLLRGDR.N
  1.6        46        1113        K.KLSLPMPI.-
  0.2        64        11.9        R.LQQAIQAK.E
Top scoring peptide matches to query 630
Elution from: 36.91 to 40.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11509744.8 FinneganScanNumber: 2749
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.6        58        1113        K.KLSLPMPI.-
  0.0        66        11.9        R.IQRQLEI.-
Top scoring peptide matches to query 631
Elution from: 26.61 to 30.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2468366.4 FinneganScanNumber: 1669
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 24.9       0.3        1114        R.LLQLCPR.L
 24.2      0.35        1135        K.LGLETGGPR.E
 19.7      0.98       -0.57        R.IDVTLSPR.D
 19.4       1.1      -13.06        R.LKSGSGPVR.I
 18.2       1.4        19.2        R.SLMPSIPR.E
 18.1       1.4        1135        R.LLGPSQER.E
 16.6         2        1098        R.QVQRRGR.R
 16.6         2        1106        K.IPFNRPR.G
 16.5       2.1        1135        R.ELQSAVPR.D
 16.1       2.3        1135        K.TTPTGGLPR.D
Top scoring peptide matches to query 632
Elution from: 26.62 to 30.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2468366.4 FinneganScanNumber: 1673
Score greater than 29 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.8       1.5        1127        R.NLMLQALP.-
 15.3       2.7        1123        R.QAILQGNR.R
 15.1       2.8      -13.04        K.KVLSNPSR.W
 15.0       2.9       -0.54        R.KAEPLASGK.G
 14.2       3.5      -13.02        R.LLSNAINR.L
 13.9       3.8      -13.02        R.KAEVINAR.E
 13.0       4.6      -13.06        K.DNVVRVAK.S
 12.9       4.8        1123        R.EAARPSLR.H
 12.8       4.9        1098        R.RQRLGGGR.M
 11.5       6.6      -13.02        R.KALDNLAR.Q
Top scoring peptide matches to query 633
Elution from: 24.06 to 28.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3501130.9 FinneganScanNumber: 1406
Score greater than 31 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 18.2       2.6        16.3                    R.SLLQAGADK.D
 16.9       3.5        14.8                    K.YRLHASR.A
 13.2       8.1       -8.61                    R.RGARVTDK.E
 11.8        11        1109                    R.EVVQLASR.C
 11.8        11        1109                    R.LDVQLASR.S
 11.7        12        1112                    R.RQQRASR.G
 10.9        14       -8.61                    GLRSVGASR
 10.9        14        19.3                    R.RRGEAASR.G
 10.7        15       -0.61    1   IPI00301263 R.YVAPPSLR.M
 10.3        16        3.85                    R.VNGSLAVSR.A
Top scoring peptide matches to query 634
Elution from: 24.56 to 28.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3501130.9 FinneganScanNumber: 1471
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.4        13        1133        R.LDVQLASR.S
 10.2        14       -0.26        R.KAALEGVSK.D
  9.9        15        1120        R.GGQKAVVSR.K
  9.1        18        1120        K.LARQAQSK.E
  9.1        18        1133        R.ASLIGTPSR.A
  8.8        19        15.2        R.SKARTPSR.V
  8.5        20        1108        K.NRLKAGSR.T
  8.2        22        1133        K.VTGGPGTKGK.G
  8.1        23        1120        R.EAIVRASR.L
  8.1        23        1133        R.EVVQLASR.C
Top scoring peptide matches to query 635
Elution from: 24.45 to 28.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3501130.9 FinneganScanNumber: 1454
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 25.4      0.42        1133        R.LDVQLASR.S
 23.6      0.63        1133        R.EVVQLASR.C
 20.4       1.3        1112        K.MVPIKGTR.S
 17.0       2.9        2.71        R.GLRSRASR.C
 17.0       2.9        15.2        GLRSVGASR
 15.1       4.4        1120        R.EAIVRASR.L
 12.3       8.5        15.1        R.TRVGGTVGR.R
 10.8        12        1133        R.ASLIGTPSR.A
 10.2        14        1133        R.NXITLTSR.N
  9.2        17        1133        K.DIAINISR.N
Top scoring peptide matches to query 636
Elution from: 24.08 to 28.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1428045.7 FinneganScanNumber: 1408
Score greater than 29 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 18.1       2.5        1128                    K.YRLHASR.A
 17.2       3.1        1129                    R.SLLQAGADK.D
 15.1       4.9       -4.36                    R.FPARVSAR.G
 13.5       7.1        1112    1   IPI00301263 R.YVAPPSLR.M
 12.3       9.5        1121                    -.MIGPIIDK.L
 11.5        11        1104                    GLRSVGASR
 11.1        12        0.12                    R.ERRISSR.G
 10.7        14        4.35                    K.KTIMPGTR.K
 10.6        14       -2.89                    R.GLGIETVSK.T
 10.2        15        1132                    R.RRGEAASR.G
Top scoring peptide matches to query 637
Elution from: 16.64 to 20.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 338280.0 FinneganScanNumber: 848
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.0       3.7        11.3        R.KLLEDYK.V
 13.0       3.7        11.3        K.LKLEDYK.D
 11.8       4.9       -1.06        -.FAKVTNTK.R
 11.7         5        1113        K.MKKPIMK.A
 10.5       6.6       -1.06        R.AGLPTQPPK.C
 10.1       7.2        1093        K.MTVALKTK.S
  8.9       9.6        1093        R.KLLMSSTK.G
  8.8       9.9        1097        R.FTIAINTK.A
  8.0        12        1097        K.EIKNYIK.A
  7.8        12        1121        K.KTRVMEK.T
Top scoring peptide matches to query 638
Elution from: 36.91 to 40.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1975478.9 FinneganScanNumber: 2748
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.0       4.6        3.25        K.AFMSKTPK.A
 10.6       7.9        11.4        R.DKKGGNYK.K
  9.1        11        1096        R.SRVDIYR.Q
  9.1        11        1096        R.KADRSGXK.E
  8.9        12        1096        QDPPPAKR
  8.0        14      -17.78        K.WHSVPRK.Q
  7.2        17        3.25        R.AVFEKGMK.A
  7.2        18        1096        R.LPEASVHR.A
  7.0        18        7.69        R.MTTREKK.V
  6.8        19      -16.28        K.DKYVEKK.F
Top scoring peptide matches to query 639
Elution from: 18.07 to 22.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 356343.6 FinneganScanNumber: 931
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.8       2.4        1121        R.AEINAHQK.G
 14.2       2.7       -9.09        K.VLCTPPPK.I
  8.5        10      -13.28        R.DPSLRPAR.T
  8.5        10      -13.29        R.LVSAHTQR.R
  8.3        10        1109        K.TMRMVLK.S
  8.2        11      -13.29        R.GRVHESVK.R
  8.1        11        1085        R.VIFKEMK.V
  7.6        12       -0.92        R.APGAAPSAAAK.S
  6.8        15        1107        R.HHPRHAR.-
  6.7        15        1113        K.NGFKLGMK.L
Top scoring peptide matches to query 640
Elution from: 36.09 to 40.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5499153.5 FinneganScanNumber: 2607
Score greater than 23 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.5       3.6        1092        K.NIQGKVPR.I
 10.0         5        1092        R.ASLSIHKR.G
  9.7       5.3        1120        K.RVLHSGSR.D
  9.7       5.3        1092        R.SLSVRPPR.G
  9.1       6.1        1104        R.VGTTALPPR.L
  8.0       7.9        1104        R.LADLQVPR.S
  7.9       8.2        11.3        K.EPSPKAKR.K
  7.3       9.2        1092        R.LAPEGRLR.R
  7.2       9.5        1120        R.SHSVLGRR.K
  6.2        12        3.14        R.MTHLALVK.G
Top scoring peptide matches to query 641
Elution from: 35.96 to 39.96 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5499153.5 FinneganScanNumber: 2585
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.0       7.9        1104        K.LPGIVAEGR.D
  6.5        11        1092        R.ASLSIHKR.G
  6.4        11        6.85        R.HTAFVIPK.K
  4.8        16        1092        R.LPQEIRR.S
  3.9        20        1095        R.GGGRRRPR.R
  3.9        20        1095        R.GGRGRRPR.A
  1.4        36      -16.30        R.ILGEPKQK.R
  1.2        37        1104        K.IPAQVDLR.R
  1.1        39        1104        R.DPLNLALR.R
  0.8        41        1092        R.ARSPKPQK.R
Top scoring peptide matches to query 642
Elution from: 36.59 to 40.57 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5499153.5 FinneganScanNumber: 2691
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8       6.6        11.3        R.IPVXQGKR.E
  8.0         8        1092        K.NIQGKVPR.I
  7.8       8.3        1104        R.DPLNLALR.R
  6.8        10      -16.32        R.ILVDLPSR.E
  5.9        13        1120        R.SHSVLGRR.K
  5.9        13        1104        R.LADLQVPR.S
  3.4        23        1092        R.ASLSIHKR.G
  2.9        26        1092        R.SVPSRLPR.R
  2.8        26       -1.05        R.RGLLGPGSR.L
  2.5        28        1115        R.HFQKPVR.I
Top scoring peptide matches to query 643
Elution from: 37.05 to 41.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 13476344.8 FinneganScanNumber: 2769
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.1       7.9        1097        R.RQKMGHR.R
  8.8        11        17.9        R.RANMHIR.D
  8.1        13        14.9        K.LMITYTR.K
  7.8        13        1090        K.SEQKKHR.Y
  7.8        13        1090        K.SQKEKHR.H
  7.7        14        1090        R.EGAAPVGRR.C
  7.6        14        1110        K.QLKACHR.E
  7.0        16        10.7        R.EEAPRGVR.M
  6.7        17       -1.58        R.KEGPNRGR.Q
  5.9        21        1115        K.EQGIPQQL.-
Top scoring peptide matches to query 644
Elution from: 33.34 to 37.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 45725306.1 FinneganScanNumber: 2256
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.2        31        18.8        R.LPARMGPR.F
  2.4        37        1114        R.HLYSKHK.E
Top scoring peptide matches to query 645
Elution from: 33.34 to 37.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 45725306.1 FinneganScanNumber: 2257
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.3       9.6        1103        R.STHVVLEK.A
  1.9        42        18.8        R.LPARMGPR.F
Top scoring peptide matches to query 646
Elution from: 33.47 to 37.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 45725306.1 FinneganScanNumber: 2265
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8       8.7        11.7        R.ALSPEGALR.R
  8.3       9.6        1104        R.STHVVLEK.A
  3.5        29        1106        R.SGPRRSPR.R
  3.2        31        1083        R.MTHLALVK.G
  3.1        32        11.6        R.LNSVEPVR.F
  2.6        36        1119        K.AASPSPARR.V
  1.9        42        1104        R.VEVPEALR.-
  1.7        44        1119        R.EPRGGQLR.T
  1.6        45        1106        R.SHTQKRR.S
  1.4        47        1119        R.EPGAAGVRR.A
Top scoring peptide matches to query 647
Elution from: 34.41 to 38.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 45717194.0 FinneganScanNumber: 2360
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.1       2.6        11.7        R.LNSVEPVR.F
  5.9        17        1091        K.NLPLDGKR.Q
  3.2        32        1091        K.SSPLPAKGR.D
Top scoring peptide matches to query 648
Elution from: 36.09 to 40.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 45573484.9 FinneganScanNumber: 2607
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.2       7.9        1119        R.EPRGGQLR.T
  7.9        11        19.1        K.ASPRMVPR.A
  7.9        11        1091        K.EPSPKAKR.K
  6.5        15        1115        R.WKPPTQR.N
  6.2        16        1083        R.MTHLALVK.G
  5.6        18        1107        R.SPSRRPGR.S
  5.5        18        1091        K.ADGKGVLPR.K
  5.4        19       -8.51        MNILAPVR
  5.1        20        1091        R.VAGTLPQAR.-
  4.7        22        1107        R.ERPRAAGR.R
Top scoring peptide matches to query 649
Elution from: 24.81 to 28.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1837037.5 FinneganScanNumber: 1499
Score greater than 26 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.5       2.1        1090        R.GLLTVDPAK.R
 12.8         5        1105        R.RAVPGAQSK.E
 12.2       5.6        1117        K.QTLTTPPR.Y
 10.9       7.5       -0.79        K.IAGITSAPGK.Q
 10.5       8.4        1105        R.AVANSRPAK.A
 10.4       8.5      -13.08        R.ALGTPTARK.R
  8.3        14        1117        M.NGPVSPKSK.A
  8.0        15        14.4        R.AGRSTPGLR.-
  7.6        16      -13.06        K.NKPKTQAK.A
  7.4        17        1117        K.ARVPDLDK.R
Top scoring peptide matches to query 650
Elution from: 30.71 to 34.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1938137.6 FinneganScanNumber: 2017
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 31.3     0.058       -0.81    1   IPI00301263 R.LGYPVLVR.A
 18.3       1.1        1111                    K.IGLACLLR.S
 17.2       1.5        1092                    R.LVAVSLASR.G
 13.1       3.8        15.9                    K.LDVISTLR.E
 11.6       5.4        3.58                    R.IAKGTTVAR.F
 11.2       5.8        1092                    K.LLVSLGASR.F
 10.6       6.8        1107                    R.RVAQKSAR.R
 10.5         7        1092                    R.KLILDSAR.A
 10.3       7.3        3.60                    R.KSKSPTLR.R
 10.1       7.7        1092                    K.LTTAQLLR.M
Top scoring peptide matches to query 651
Elution from: 30.80 to 34.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1938137.6 FinneganScanNumber: 2026
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 33.5     0.035       -0.81    1   IPI00301263 R.LGYPVLVR.A
 18.0       1.2        1092                    K.LSLTAAALR.D
 16.7       1.7        1092                    R.LSDLAKIR.K
 16.0         2        1080                    K.AVTLRSLR.S
 14.9       2.5        1092                    M.ALEKSLVR.L
  9.7       8.4        1080                    K.ITLSRAVR.T
  9.4       8.9        15.9                    K.LDVISTLR.E
  8.7        11        1092                    R.LSVLASGLR.A
  7.8        13        1092                    K.LLVSLGASR.F
  7.1        15        3.58                    R.LGTLTQKR.R
Top scoring peptide matches to query 652
Elution from: 36.98 to 40.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3265365.7 FinneganScanNumber: 2760
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.5       1.9        1099        R.SKKALANAL.-
  6.4        16        1112        R.IQKDLVLS.-
  6.3        16        11.0        K.SQLVRVSK.N
  5.3        20        11.0        K.KNKGQLTK.S
  2.1        42        1110        R.VPRPPPPR.H
  1.3        51        1112        R.ELALQITK.E
  1.3        51        1112        K.LEPSKITK.F
  1.2        53        18.1        -.MGKVRGLR.A
  1.1        54        1099        K.IESIGLKR.T
  1.1        54        11.0        R.SQSLRVVK.R
Top scoring peptide matches to query 653
Elution from: 36.94 to 40.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3265365.7 FinneganScanNumber: 2753
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.2      0.66        1099        R.SKKALANAL.-
  2.5        40        1099        M.ALEKSLVR.L
  2.5        40      -16.48        R.LASVASKLK.E
  2.5        40        1114        R.QALKSRGR.R
  2.3        41        1112        K.SLPAVTSLK.S
  1.6        48        1112        R.GELLAATLK.G
  1.4        50        1087        R.SVRSVVLR.A
  1.3        51        15.2        K.GLMILIEK.E
  1.2        52        11.0        K.SRVDALKK.E
  1.1        53        1099        R.IKIQGATGK.F
Top scoring peptide matches to query 654
Elution from: 34.22 to 38.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12424986.4 FinneganScanNumber: 2335
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.3        22        1099        K.LDVISTLR.E
  3.1        37        11.5        K.ELTLASKR.E
Top scoring peptide matches to query 655
Elution from: 30.67 to 34.67 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18486121.1 FinneganScanNumber: 2011
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 14.7       2.5        1082    1   IPI00301263 R.LGYPVLVR.A
  8.3        11        1114                    R.RGGIGVTTR.S
  8.3        11        1086                    R.KSKSPTLR.R
  6.9        16        1086                    K.LSKAALGTR.R
  4.7        26        1114                    R.QSLLGSRR.G
  4.7        26       -0.67                    K.SVKGKATAR.D
  4.6        26        1086                    R.LVVTGKSGR.G
  4.0        30        11.6                    K.EITSAIKR.V
  3.6        33       -8.73                    K.ILAMKAVR.N
  3.3        35        1114                    R.KSERQIR.L
Top scoring peptide matches to query 656
Elution from: 38.02 to 41.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4912857.8 FinneganScanNumber: 2932
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.7       5.2        1099        K.LDVISTLR.E
 10.6       6.7       -0.65        K.KTKGSLQR.E
  7.5        13        1086        R.SQSLRVVK.R
  6.2        18        1086        K.SLIGAARTK.T
  6.0        19        1099        R.QELASKIK.E
  6.0        19        1102        K.SATRRVAR.T
  5.7        20        1109        K.AVSRLWGK.H
  5.7        20        1078        R.AKTIMPKK.V
  5.4        22        1099        R.EKLEAAKK.K
  5.3        22        1099        K.EKIQTGLK.K
Top scoring peptide matches to query 657
Elution from: 18.98 to 22.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 930791.7 FinneganScanNumber: 992
Score greater than 33 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 26.8      0.31       -0.97    1   IPI00301263 R.VFNTGGAPR.I
 18.9       1.9        1089                    M.GSQSSKAPR.G
 16.6       3.2        1109                    R.MPSRASPR.R
 15.9       3.8        1089                    K.ASPSSANKR.K
 14.1       5.8        1089                    R.ERSADLAR.F
 14.1       5.8        15.7                    M.SSAPASGSVR.A
 13.8       6.2        1084                    -.MRGRGNAR.S
 12.0       9.4        1102                    R.DVDGATLAR.L
 11.6        10        1109                    R.CGAPASKAR.E
 11.5        11        3.45                    R.SRSSASAPR.R
Top scoring peptide matches to query 658
Elution from: 19.06 to 23.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 373909.6 FinneganScanNumber: 998
Score greater than 32 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 44.3    0.0056        1093    1   IPI00301263 R.VFNTGGAPR.I
 16.7       3.2        4.97                    -.MVPASRSR.E
 14.6       5.2        1077                    K.ARMGSAGLR.V
 11.6        10        1110                    M.SSAPASGSVR.A
 10.3        14        1090                    K.MAKAPSAAR.S
  9.4        17        1102                    -.MGNVPSAVK.H
  8.6        21        1110                    R.GASQGTIER.C
  8.5        21        1102                    -.MDIPISSR.D
  8.5        21        17.2                    R.EASICALR.Q
  8.3        22        12.8                    R.VMEHFIK.L
Top scoring peptide matches to query 659
Elution from: 27.92 to 31.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6458357.3 FinneganScanNumber: 1789
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.6       2.4        2.18        K.RRSHLPR.V
 12.7         3        14.4        R.RHIATAPR.H
 12.2       3.3        2.18        K.RSLHRPR.F
  9.8       5.7        1097        R.RGLGPPPAR.G
  8.5       7.7        10.0        K.RWPPPLR.W
  7.4       9.9        14.4        K.SHGLVRPR.V
  7.3        10      -12.93        K.RVLKSYR.E
  7.0        11      -12.93        R.RSYLKVR.E
  7.0        11       -5.11        K.LFYLLPR.T
  6.8        11        1097        R.RGPAPGPLR.V
Top scoring peptide matches to query 660
Elution from: 27.74 to 31.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6458357.3 FinneganScanNumber: 1777
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.4      0.63        1109        K.AQALFKSR.E
 14.2       2.1        2.18        K.RRSHLPR.V
 13.2       2.6        14.4        R.RHIATAPR.H
 11.4       3.9        1109        R.LLHSPTPR.T
 10.8       4.5        1082        K.ALLATLYR.N
  7.6       9.4        14.4        K.DLRHKPR.E
  7.6       9.4        2.18        K.RSLHRPR.F
  7.6       9.5       -5.11        K.LFYLLPR.T
  7.3        10        1085        R.APRARPPR.S
  7.3        10        1085        R.ARPRPAPR.T
Top scoring peptide matches to query 661
Elution from: 27.72 to 31.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6458357.3 FinneganScanNumber: 1774
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.8       1.8        14.4        R.RHIATAPR.H
 12.2       3.3        14.4        R.GPKGRPGPR.G
 11.7       3.7        1097        RLKAYNR
 11.7       3.7        2.18        K.RRSHLPR.V
 11.7       3.7        2.18        K.RSLHRPR.F
 11.4       3.9        14.4        K.DLRHKPR.E
 10.9       4.4        1097        R.GPQPPRIR.A
  9.1       6.7        14.4        R.RKPHLDR.R
  8.4       7.8        2.18        R.RSPHLRR.W
  7.9       8.7        1097        R.NKAVVHPR.R
Top scoring peptide matches to query 662
Elution from: 22.00 to 26.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 551503.8 FinneganScanNumber: 1230
Score greater than 16 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.3       1.7        1091        K.NEMENER.W
  8.2       1.7        1084        K.NEEEGESK.D
  2.8       5.9        1074        -.MSHPDYR.M
Top scoring peptide matches to query 663
Elution from: 37.26 to 41.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2102979.8 FinneganScanNumber: 2810
Score greater than 26 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.8      0.99       -4.00        R.GNSRSMXK.G
 12.6       5.2        1103        K.MTRGRQSS.-
 10.7         8        1092        K.KPAYDGGSK.I
  9.5        10      -12.02        M.QMTMRLK.S
  9.2        11        1100        K.LLMEEGSK.A
  7.8        15        1076        -.MSATAAARK.R
  6.3        22        3.81        K.LPSYGMQK.E
  6.0        23        1103        -.MMPLWTK.D
  5.2        28        1100        R.SEVESLMK.K
  5.1        29        1108        -.MMENLIR.G
Top scoring peptide matches to query 664
Elution from: 37.23 to 41.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2102979.8 FinneganScanNumber: 2801
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.6        10        1108        K.KNMTGPMK.R
  9.1        12        8.16        R.DAMRSVTK.Q
  8.5        13        1099        R.WQMSARK.A
  6.8        20        1080        R.FQSAADKR.A
  6.6        20        1100        R.MLGELESK.I
  6.5        21        1100        R.SLLEMEGK.E
  6.4        21        1069        K.TSEKKDSK.E
  6.0        23        3.81        R.WMKTTEK.G
  6.0        24        1095        K.SSNRHGHK.R
  5.8        25        1081        K.LTTTETEK.K
Top scoring peptide matches to query 665
Elution from: 26.71 to 30.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11960866.1 FinneganScanNumber: 1683
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.6       1.1       -1.61        R.SSLPPGIPR.F
 10.2       5.9        1106        K.RIDSYLR.E
  9.8       6.4       -1.61        R.SPSPAVPLR.V
  9.8       6.4      -13.78        K.SALIVHQR.T
  9.6       6.7        13.5        R.IHDNRIR.K
  9.5         7        1085        R.HLVLMGPR.L
  9.3       7.2        1081        R.LHNLRGGR.I
  8.3       9.2        1094        R.ASPRAPAPR.A
  8.2       9.3        1.34        R.HNARAAKR.A
  8.1       9.6        1.32        K.RQPRNPR.T
Top scoring peptide matches to query 666
Elution from: 26.57 to 30.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11960866.1 FinneganScanNumber: 1665
Score greater than 28 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.6       1.7        1085        R.HLVLMGPR.L
 14.5       2.2        1069        R.RNAHLRR.H
 11.8         4       -1.61        R.SSLPPGIPR.F
 10.7       5.3        13.5        R.TPHTVRGR.E
 10.3       5.8       -1.61        R.SPSPAVPLR.V
 10.2       5.9        1.34        R.HNARAAKR.A
 10.1       6.1        1089        R.IFRSFPR.G
 10.1       6.1        1089        K.LFRSFPR.K
  9.7       6.6        1081        R.LHNLRGGR.I
  9.6       6.8        13.5        R.IHDNRIR.K
Top scoring peptide matches to query 667
Elution from: 29.01 to 33.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1688119.6 FinneganScanNumber: 1871
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 23.3       0.4       -0.77   15   IPI00019502 R.VVFQEFR.Q
 11.2       6.4       -8.55                    R.QKXHPTAR.T
  9.6       9.2        1070                    R.SHPVSALGR.S
  8.5        12        1105                    R.TPAAGGFFR.R
  8.0        13        1082                    R.ASTYGVAVR.V
  7.8        14        1070                    K.LHLEQQR.I
  7.8        14        1074                    R.VVFLGNMK.R
  6.8        18        1082                    R.SLYSLGGAR.S
  6.3        20       -8.57                    R.GLHSQGLGR.G
  6.3        20        3.59                    M.GNTTTKFR.K
Top scoring peptide matches to query 668
Elution from: 26.62 to 30.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4965822.1 FinneganScanNumber: 1672
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.8      0.94        8.72        R.KSTAPPAPR.M
 11.8       3.7        1088        R.SSLPPGIPR.F
 10.2       5.4        1075        K.SALIVHQR.T
  9.7       6.1        0.70        R.VVMPPIPR.H
  9.7       6.1        8.72        R.AQPATALPR.L
  9.6       6.2       -3.44        R.SAPRLAGRP.-
  8.5       7.9        1075        K.HLSIGGALR.Y
  8.3       8.3        8.71        R.GLPSQGLPR.K
  8.2       8.6      -15.60        R.TAPRARPR.S
  7.8       9.4        1091        R.HNARAAKR.A
Top scoring peptide matches to query 669
Elution from: 25.01 to 29.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 917361.1 FinneganScanNumber: 1524
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.8       2.2        15.1        R.LDPAARGAR.L
 10.4       6.1        1079        R.RAVAAQPGR.K
 10.4       6.1        1079        R.RAVAQGAPR.E
  9.3       7.8        1079        K.RAVGAAAPGR.S
  8.5       9.4      -12.09        R.LDARNPLK.Q
  7.9        11      -12.12        R.AGVVPSQLR.V
  7.2        13        15.1        R.RAAPTXGTR.A
  7.1        13        15.1        R.RSLPGSGPR.L
  6.6        15        0.05        K.VKKSSYSK.K
  6.4        15        1077        K.KVTLSYSK.N
Top scoring peptide matches to query 670
Elution from: 25.03 to 29.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 917361.1 FinneganScanNumber: 1528
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.0      0.67        1079        R.RAVAQGAPR.E
 19.0      0.84        1079        K.RAVGAAAPGR.S
 18.3      0.99        15.1        R.LDPAARGAR.L
 16.8       1.4        15.1        K.INPKNGQR.E
 12.6       3.7      -12.10        R.GILVASNPR.G
 12.3         4        1079        R.RAVAAQPGR.K
 11.8       4.5        1092        R.GVAGGLAPQR.K
 11.1       5.2        0.05        R.ILDAPEIR.N
 11.0       5.4      -12.09        R.LNPADIKR.A
  8.3       9.8      -12.12        R.AGVVPSQLR.V
Top scoring peptide matches to query 671
Elution from: 27.62 to 31.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 287657.4 FinneganScanNumber: 1765
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.4       2.9        3.37        R.EGLPSAPTR.V
 10.6       6.9       -8.75        R.GRSASPPQK.R
 10.3       7.3        3.37        R.EVAEGGLPR.A
  9.5       8.9       -8.73        K.RADPAELR.T
  7.9        13        3.36        R.TPPTASPTR.T
  7.5        14        1098        R.QGTAPPPMK.L
  6.9        16       -8.76        K.AGKPGSPGTR.R
  6.4        18        1094        K.MTKKMQK.T
  6.1        19        1067        R.QVSHAKEK.L
  6.1        19       -8.78        K.GGSAVGGGPLR.K
Top scoring peptide matches to query 672
Elution from: 35.34 to 39.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1866105.1 FinneganScanNumber: 2481
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4        14        1099        K.VEEPEPVK.K
  7.2        15        1090        R.IFAFICR.K
  7.0        15        1102        K.SKQHQGNK.D
  6.8        16       -0.56        R.GGGGTVVGAPR.G
  6.2        18        11.6        R.NSPGVPTGAK.K
  5.4        22        1087        K.SPEDLPLR.L
  4.4        28        1075        R.NLVHSGATK.G
  4.1        30        1067        K.LLSYRMK.K
  4.0        31      -12.65        K.QPVRGASGR.T
  3.4        35       -0.53        R.ATQGLGAGPR.E
Top scoring peptide matches to query 673
Elution from: 36.31 to 40.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 943425.2 FinneganScanNumber: 2642
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.3        27        1072        R.TAQLVLQR.M
  5.8        30        14.4        K.ARRVGQSR.L
  4.5        41        1085        R.AKVPKEEK.A
  4.4        42        1100        R.EAVRQGIR.D
  4.2        44        7.17        K.AAWVIIEK.Y
  4.2        44        14.4        K.AGSIRGRGR.G
  2.6        63        1100        M.ARQDLAVR.F
  2.1        71        1087        R.ARQERLR.Q
  1.9        75       -8.56        K.AIPIMKTR.S
  1.8        76        1100        R.ALRSPAASR.A
Top scoring peptide matches to query 674
Elution from: 36.56 to 40.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 943425.2 FinneganScanNumber: 2687
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8        18        1071        K.GAVGRVLTR.N
  7.7        19        1084        K.EVKNAVIR.V
  7.0        22       -1.50        R.VRGSGKVAR.A
  4.4        40      -16.47        K.ADITKLIR.R
  4.0        44        1084        K.EARLALQK.I
  4.0        44        1076        K.ILGLPLMR.Q
  2.3        65        1084        R.TQLLGQLR.A
  1.7        74        1071        R.KPRTASLR.A
  1.3        80        1096        R.EPKKEAVK.S
  1.2        83        10.6        R.GGLKQLSAR.N
Top scoring peptide matches to query 675
Elution from: 34.41 to 38.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8453258.9 FinneganScanNumber: 2359
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.0       6.3        1098        K.AKQERAAR.I
 12.5       7.2        11.3        SLKENLAR
  9.4        15        1090        -.MEPKRIR.E
  7.6        22        19.0        K.SLLVAEWL.-
  5.4        37        1083        R.AGTLEALVR.H
  5.0        40      -15.81        R.KTVQVIKD.-
  4.6        44        9.83        R.APFAGRRR.R
  4.2        48        11.3        R.ISAVSVAQR.V
  4.2        49        1098        M.LSGAAGAARR.G
  4.2        49        1083        R.SLKESPLR.S
Top scoring peptide matches to query 676
Elution from: 33.45 to 37.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10188600.1 FinneganScanNumber: 2264
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.8       8.4        1083        K.LSLVPSSAR.L
 11.3       9.3        1083        K.IPSEKLSR.I
 10.7        11        1071        R.TVDLLGRR.V
 10.5        11      -15.62        K.LSALAEAKK.L
  9.1        16        18.4        R.MVPRAGKR.T
  9.1        16        18.4        K.MVPRKQR.E
  8.9        16        1071        R.IDLSRLGR.Q
  8.5        18        1095        K.DVQLDLVK.K
  8.3        19        1083        K.EKLLAAER.A
  8.1        20        1083        K.DSLLGGVLR.V
Top scoring peptide matches to query 677
Elution from: 33.53 to 37.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10296487.0 FinneganScanNumber: 2275
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.3        12        1098        K.GARLAAAGSR.R
  8.6        17        1086        K.ARRVGQSR.L
  7.2        24        1083        R.AGTLEALVR.H
  6.3        30        1083        R.EAALAKQAK.I
  5.8        33        11.4        R.EKALEKGR.L
  5.7        34        1095        K.TPLTIGAEK.L
  5.6        35        1083        R.LQDVKAQK.V
  5.5        36        1071        R.NKKTPVSR.S
  5.3        38       -0.66        R.RKTDAAIR.E
  5.2        38        11.4        K.LKTIDQGR.E
Top scoring peptide matches to query 678
Elution from: 29.65 to 33.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 708608.5 FinneganScanNumber: 1936
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 10.1        12        5.00                    K.SVVRPGYR.G
  8.1        18        6.43                    R.VTIAVDTSK.N
  7.6        20        19.9   22   IPI00169307 R.RHTLGGHR.D
  7.4        21       -5.60                    R.TAITTASIR.R
  7.2        22       -7.02                    R.KEKVHHR.K
  7.2        22        5.03                    R.EALARFAR.A
  6.4        27        1058                    R.RKLCSIR.N
  5.5        33        1.40                    R.RTLQMLR.E
  5.3        34        17.1                    R.YAVPSAGLR.L
  4.8        39        1090                    R.AGKGTLNGSK.D
Top scoring peptide matches to query 679
Elution from: 37.05 to 41.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 488789.5 FinneganScanNumber: 2768
Score greater than 20 indicates homology
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.1       2.8        1091        K.TSLKAATIK.A
  7.0       3.6        1091        K.KDVTTKLK.A
  5.8       4.8        1091        K.IEKSKSLK.Q
  3.0       9.3        6.00        R.ALRFVLSK.H
  2.0        12        1091        K.ISSKLGSLK.L
  1.6        13        1079        K.SLRTVKTK.M
  0.7        16        1079        K.VKTTKVTR.-
Top scoring peptide matches to query 680
Elution from: 38.69 to 42.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1482726.6 FinneganScanNumber: 2993
Score greater than 16 indicates homology
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.6       4.1        1092        K.IEKSKSLK.Q
  6.3       4.3       -4.94        K.IKGPLHIR.A
  3.5       8.3        1072        -.MVLKKGIK.F
  2.1        11        1063        R.QRFLKLK.Y
  2.0        12        1063        R.FRQILKK.I
  1.8        12        1063        K.RKFAGLLK.N
  1.6        13        1080        K.SLRTVKTK.M
  1.6        13        7.11        R.KISFIIGR.H
  1.6        13        1063        K.LRYKPKK.S
Top scoring peptide matches to query 681
Elution from: 34.36 to 38.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 838245.1 FinneganScanNumber: 2356
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.1        14        4.47        R.SCTSVILR.W
  9.4        16        4.48        R.MSNLSVLR.S
  8.7        19        4.47        K.CSVLSTLR.G
  7.9        23        1093        K.AEMWLIR.T
  7.5        25       -7.53        -.XGNRKTTK.E
  7.0        28        8.09        R.QGYLDALR.F
  6.7        30      -15.47        -.MGVVMKVR.I
  6.6        31        0.17        R.MAFGAPLTK.L
  6.3        33       -7.53        K.DTKMRIR.A
  6.0        36        1062        R.LFSGVANAR.Y
Top scoring peptide matches to query 682
Elution from: 18.07 to 22.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 207042.3 FinneganScanNumber: 934
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.5         3       -9.29        R.AAMDAVCAK.V
  8.8       5.7       -1.38        -.MAGAAAESGR.E
  8.2       6.6       -1.38        -.MSNTQAER.S
  6.4       9.8        1084        K.ESDKEDGR.E
  5.9        11        2.70        R.VPMMSDPK.A
  5.8        11        1064        -.MATAEPSGR.A
  5.5        12        10.6        K.VNEDMNAK.L
  4.9        14        10.6        K.MADEDALR.K
  4.6        15        1071        K.GGGCALMNR.S
  3.7        18        1067        K.SAATWDER.F
Top scoring peptide matches to query 683
Elution from: 21.53 to 25.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 215338.6 FinneganScanNumber: 1179
Score greater than 27 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 17.6      0.94        1086                    K.RKSSTMVK.E
 13.4       2.4        10.7                    K.NVYLTVTK.E
 12.6       2.9       -1.33    1   IPI00301263 R.RLSSFVTK.G
 11.7       3.6        1089                    R.KAFDRATK.L
 11.7       3.6        1089                    R.RSSVNFVK.W
 11.1       4.1       -9.21                    K.ILGFMKTK.D
 11.1       4.2        1062                    K.FVSQKISK.T
 11.0       4.2        1062                    R.VVNFTKTK.L
 10.9       4.3       -5.61                    R.FPSFLKAK.V
 10.4       4.9        1063                    K.EVPAPPKAK.A
Top scoring peptide matches to query 684
Elution from: 30.73 to 34.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 243775.6 FinneganScanNumber: 2020
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 23.4      0.37       -1.13   16   IPI00397526 R.IVFQEFR.Q
  9.6       8.8        18.0                    R.NPRNGQPR.R
  9.3       9.5       -8.81                    R.ANHQVLTR.L
  7.0        16       -8.81                    R.RAPGPPTSR.R
  6.9        17        1066                    R.LARTSFDK.N
  6.7        17      -13.09                    R.LPSYRFR.Y
  6.5        18        3.19                    K.DPQIAAAPR.N
  6.5        18        1066                    R.GTSIKEFR.E
  6.1        20        1078                    R.IVASASFDK.S
  5.4        24        1066                    K.VLPAHDASK.V
Top scoring peptide matches to query 685
Elution from: 36.17 to 40.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12991272.8 FinneganScanNumber: 2620
Score greater than 27 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.5       1.5      -15.66        K.IDVPTLGPK.E
 13.8       2.1       -0.81        K.NNVLVQPR.D
 12.0       3.3      -12.78        K.AGHGKSKVR.L
 10.6       4.5        1061        R.LSPQPQIR.A
  9.9       5.2       -0.83        K.AISGVHTVR.F
  9.0       6.5        1061        K.SLGHGLINK.K
  7.1        10        1080        K.LSMIRFR.Y
  5.9        13        1061        R.KQAPEPLR.A
  4.8        17       -5.09        R.KAFLSAFR.C
  4.4        19        1080        R.VMPPGKGPR.L
Top scoring peptide matches to query 686
Elution from: 36.38 to 40.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12991272.8 FinneganScanNumber: 2656
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.4        12        1061        K.SLGHGLINK.K
  5.8        13        1061        M.ILLNNSHK.L
  0.8        43        1088        R.LEGPGPRGR.T
Top scoring peptide matches to query 687
Elution from: 36.49 to 40.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12991272.8 FinneganScanNumber: 2676
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.7        18      -15.57        K.EALATPLPK.D
  3.7        22        1073        K.EQNLPLPK.R
  3.2        25        1088        K.SNGAILAHR.N
  1.6        36        6.93        R.EFFKLQK.I
  1.3        38        1088        R.QLKAEGHR.V
  0.5        46        1076        K.AHSQARLR.A
Top scoring peptide matches to query 688
Elution from: 31.69 to 35.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 599999.9 FinneganScanNumber: 2107
Score greater than 23 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.3       2.4        13.4        R.RLNWVPR.H
 11.8       2.7        14.9        R.LLALEPER.R
 10.1       3.9        2.90        R.NKVVPVER.-
  8.9       5.2        1063        R.APELLLGAR.H
  8.5       5.7        17.7        K.RLPNRER.L
  7.1       7.9        2.92        K.SSLKLGAHK.Q
  6.8       8.4        5.76        R.GRGRGRPGK.R
  5.9        10        2.92        R.AAEPGLVKR.A
  5.8        11       -9.05        R.LPNSVVRR.L
  5.7        11       -9.05        -.XPAQGKRGK.K
Top scoring peptide matches to query 689
Elution from: 31.80 to 35.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 334323.3 FinneganScanNumber: 2121
Score greater than 28 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.0      0.94        0.09        K.QLRGQIAR.R
 14.5       1.7        1059        R.ILQRTPGR.V
  8.8       6.1        12.0        K.VKTTRVTH.-
  8.3         7        12.0        R.RTTPLPTR.R
  8.1       7.2        1059        K.KIRVDGPR.G
  7.9       7.6      -14.70        K.LEPSRIVK.Q
  7.7       7.9        1071        R.NLQLSLPR.E
  7.7         8        1055        K.KLLPWQR.R
  7.0       9.4        1071        R.GTVVPGAALR.V
  6.9       9.5        0.09        K.RGQKSIPR.E
Top scoring peptide matches to query 690
Elution from: 16.53 to 20.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 655666.8 FinneganScanNumber: 838
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.0       2.9       -3.95        R.QIAQEIIK.G
 13.8         3       -3.95        K.ELVLNINK.L
 13.4       3.4       -3.95        R.KLTLPENK.A
 11.6       5.1       -3.96        K.KEDKVPVK.K
 10.8       6.1       -3.98        R.LQGDAVVLK.I
  9.4       8.3        1065        K.KRYSIFK.Y
  9.1       9.1      -15.89        K.DRSLKPVK.I
  8.9       9.3        10.8        R.RTLSVGPGR.E
  8.2        11        1049        R.KMLHLRK.Q
  8.0        12        1061        -.MKPLLPAR.S
Top scoring peptide matches to query 691
Elution from: 26.97 to 30.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 589824.2 FinneganScanNumber: 1711
Score greater than 30 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.2       1.1      -10.85        R.TRTRRPR.T
 16.6       1.6      -13.68        K.ASLKSPALR.R
 13.1       3.6        13.0        K.TKSRTPPR.R
 11.3       5.4        13.0        -.XPAQGKRGK.K
 10.5       6.6        1.08        R.KKGGSGRPR.K
 10.2         7      -13.67        K.LAEARLAAK.R
  9.9       7.5        1078        -.MIPRRPR.E
  8.6        10        1055        R.KGLWGKPR.G
  8.3        11       -1.79        R.TLGSQPVLK.T
  8.1        12        8.71        R.TGLVHFLR.E
Top scoring peptide matches to query 692
Elution from: 33.03 to 37.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2200211.1 FinneganScanNumber: 2222
Score greater than 27 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.9       1.4        10.2        R.MARAKLPR.S
 16.8       1.5       -4.59        -.MLLLLPSR.S
 13.7         3        3.27        K.ASLKSPALR.R
 13.1       3.4        15.2        R.TLGSQPVLK.T
 12.8       3.7       -8.66        R.REKGILAR.S
 11.7       4.8      -11.53        K.EVELILVK.E
 11.5       4.9        3.28        R.AKLEAAIAR.M
 11.0       5.6        1076        K.QLRGQIAR.R
 10.4       6.3        18.0        R.RSRALSPR.L
  9.5       7.8        3.25        K.DRSLKPVK.I
Top scoring peptide matches to query 693
Elution from: 33.01 to 37.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2200211.1 FinneganScanNumber: 2221
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.7         3        3.25        R.IQLVKDAR.R
 13.3       3.3        3.24        R.VLQISAGVR.Y
 12.6       3.9        18.0        R.RIRASSPR.V
 12.1       4.4        18.0        R.RSRALSPR.L
 11.0       5.5        1049        R.IKNAIGVAR.K
 11.0       5.6        1049        R.SSPLLLRR.L
 10.7         6        1049        -.XTRLVSPR.D
 10.7         6        1049        -.XTRLVSPR.D
 10.3       6.5        1049        R.RLVGEIVR.R
  9.9       7.2        1076        R.GGRVAAAALR.S
Top scoring peptide matches to query 694
Elution from: 26.97 to 30.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5579604.8 FinneganScanNumber: 1712
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 24.2      0.41        3.58        R.QGLIMLPR.L
 21.7      0.72      -15.25        K.EAATLLVAR.D
 20.3      0.99        1079        R.QWSLRPR.G
 20.2         1        1079        R.QRLSWPR.T
 17.0       2.1       -0.47        R.GAAAALSRAR.V
 16.6       2.3        1057        K.TVVRQSPR.R
 16.4       2.4       -4.74        K.EIRIWAR.K
 16.4       2.4       -4.74        R.ELRLWAR.G
 16.4       2.4        11.4        K.ERLIEQR.D
 15.6         3        1079        K.SLARGWPR.G
Top scoring peptide matches to query 695
Elution from: 25.33 to 29.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22116045.6 FinneganScanNumber: 1560
Score greater than 30 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.7       1.5        1080        K.SLARGWPR.G
 16.1       2.7        4.66        R.SNPLILMR.L
 13.9       4.5        4.63        K.LSIVPVCR.G
 13.9       4.5        1070        R.QALPVATSR.E
 13.7       4.7        4.65        R.QGLIMLPR.L
 12.4       6.4        1046        R.AKAVGRGQR.A
 12.4       6.4        1058        K.AQAQLQKR.Y
 12.4       6.4      -14.18        K.EAATLLVAR.D
 12.4       6.4        12.5        R.SIAQAAVQR.C
 12.0         7      -14.20        K.TVSPALISR.F
Top scoring peptide matches to query 696
Elution from: 25.89 to 29.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22119806.3 FinneganScanNumber: 1602
Score greater than 29 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.5         2        1070        R.EGTLAAKPR.M
 15.6       3.1        12.6        K.SLDSRLPR.D
 15.2       3.4      -14.16        R.GTLVGDILR.V
 14.1       4.3        1080        K.SLARGWPR.G
 14.0       4.4        4.70        R.QGLIMLPR.L
 13.7       4.7      -14.13        K.EAATLLVAR.D
 13.2       5.2        4.72        -.DIKMALPR.S
 13.1       5.4        1058        K.TVVRQSPR.R
 12.9       5.7      -14.14        K.TLATTLAPR.V
 12.6         6        12.5        R.VSTVERPR.W
Top scoring peptide matches to query 697
Elution from: 24.77 to 28.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22119806.3 FinneganScanNumber: 1495
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 26.5      0.25        12.6        R.VSTVERPR.W
 25.3      0.33      -14.11        K.EAATLLVAR.D
 20.2       1.1      -14.13        K.TLATTLAPR.V
 15.8       2.9        1070        R.VAVQGDVVR.E
 15.4       3.2        1058        K.AQAQLQKR.Y
 15.3       3.3        1046        R.AKAVGRGQR.A
 15.2       3.4      -14.13        K.TVSPALISR.F
 14.4         4        1046        R.RIRASSPR.V
 13.8       4.6      -14.13        R.AISVILGDR.W
 13.8       4.6        12.6        K.VSRSLEPR.S
Top scoring peptide matches to query 698
Elution from: 24.75 to 28.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22119806.3 FinneganScanNumber: 1492
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 23.9      0.45        1058        R.RALGTPTAR.K
 19.9       1.1        1046        K.RALAAERR.L
 19.5       1.2        12.6        K.AAAAGTKTPR.R
 18.5       1.6        8.29        K.FGKPELPR.Q
 16.9       2.3        1046        R.RAPRTVSR.N
 16.3       2.6        12.6        R.IAEAGGKAAR.A
 16.3       2.6        1070        K.LVQNNLGGK.V
 15.8       2.9      -11.26        R.RASGRLAGR.K
 14.9       3.6        1058        K.RVSNTPLR.T
 14.7       3.8        0.67        R.GAAAALSRAR.V
Top scoring peptide matches to query 699
Elution from: 24.69 to 28.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22119806.3 FinneganScanNumber: 1487
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.0       0.7      -14.11        K.EAATLLVAR.D
 19.6       1.2        1058        K.AQAQLQKR.Y
 19.3       1.3        1070        R.VAVQGDVVR.E
 15.4       3.2        1053        R.TGLVHFLR.E
 15.0       3.5        12.6        K.AAAAGTKTPR.R
 14.9       3.6        4.74        -.DIKMALPR.S
 14.6       3.8        1058        -.XPAQGKRGK.K
 14.4         4        12.6        R.SIAQAAVQR.C
 13.9       4.5      -14.12        K.TLATTLAPR.V
 12.5       6.3        12.6        R.AAQKQLER.E
Top scoring peptide matches to query 700
Elution from: 24.67 to 28.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22119806.3 FinneganScanNumber: 1486
Score greater than 32 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.4      0.64        12.6        K.AAAAGTKTPR.R
 18.4       1.6        1082        K.VLTEPEVR.Y
 16.8       2.3        0.62        R.RLGGGLGGTR.R
 16.4       2.6        12.6        R.VSTVERPR.W
 15.6       3.1        8.30        K.FGKPELPR.Q
 15.3       3.3        1058        R.LRGSGTPVR.G
 15.2       3.4        1046        R.RPASLRSR.S
 15.2       3.4        12.6        K.VSRSLEPR.S
 14.0       4.4        1046        R.RIRASSPR.V
 14.0       4.4        19.5        K.KRLGCGPR.D
Top scoring peptide matches to query 701
Elution from: 24.67 to 28.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 22119806.3 FinneganScanNumber: 1485
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.2       2.7        1058        K.RVSNTPLR.T
 14.9       3.5      -14.12        K.TLATTLAPR.V
 14.5       3.9        1082        K.TGPLGLAGEK.G
 13.6       4.8        1046        R.KKGGSGRPR.K
 12.3       6.5        1070        R.EGTLAAKPR.M
 11.8       7.4        8.30        K.FGKPELPR.Q
 11.3       8.3        1080        R.GXWTLGPR.G
 11.2       8.5        1046        R.RSRALSPR.L
 10.9       9.1        1058        K.TKSRTPPR.R
 10.8       9.1        12.6        K.VSRSLEPR.S
Top scoring peptide matches to query 702
Elution from: 37.12 to 41.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 14202211.3 FinneganScanNumber: 2783
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.9        25        14.1        K.QLRSAGRR.D
  4.8        32        11.2        K.EAATLLVAR.D
  4.2        37        1068        R.LQGDAVVLK.I
  3.6        41        1083        R.TPPTSRKR.S
  3.3        45        11.2        K.QAQIVKEK.V
  3.0        48       -0.70        K.KLEEIRR.L
  3.0        48       -0.70        R.KLEELRR.Q
  2.8        51      -12.64        R.KVGRSLQR.G
  2.5        54        1083        R.IQKAGGNVR.D
  1.6        66        1068        R.VLALLEER.T
Top scoring peptide matches to query 703
Elution from: 37.13 to 41.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 14202211.3 FinneganScanNumber: 2786
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
  7.9        16        1083                    -.XPAQGKRGK.K
  7.3        18        1083                    R.EIGAQLRR.M
  7.2        18       -0.71   27   IPI00007675 R.SRSKLPAGK.N
  6.5        21        1083                    R.LGAGNKIGGR.R
  6.5        21        1083                    K.AGNKGAVGIR.F
  6.0        24        1068                    R.LQGDAVVLK.I
  4.2        36       -0.71                    K.AALGSALRGK.E
  4.1        37        9.78                    K.WQLRRGK.K
  4.0        38        1083                    R.ELQQRLR.V
  3.2        46        1083                    R.IQEQLRR.L
Top scoring peptide matches to query 704
Elution from: 37.18 to 41.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 14202211.3 FinneganScanNumber: 2795
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8        16        1083        R.TPPTSRKR.S
  7.3        18       -0.69        K.AKQLKAER.G
  3.6        41        1056        K.LLVNQSIR.L
  2.9        50        1056        R.AKLEAAIAR.M
  1.8        64        1056        K.VQEVLKAR.T
  0.1        93        1083        M.SPGEIKRR.V
  0.0        95        1083        R.ALGELRQR.C
Top scoring peptide matches to query 705
Elution from: 25.91 to 29.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 841388.8 FinneganScanNumber: 1606
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 25.4      0.26        1072        K.TVEEAAAPR.E
 21.8      0.59        15.7        R.TTAGVGDPAR.T
 21.1      0.71        15.7        K.EAAALEQGR.K
 18.6       1.3        1072        K.TPATTPEAR.V
 16.7       1.9        1048        R.QAANVRER.R
 15.1       2.8        1079        R.QAQCLAPR.-
 13.7       3.8       -4.01        R.ASLMPAQAR.A
 13.4       4.1       -4.02        R.AVLQMNPR.M
 13.3       4.2        15.7        R.TASAPNLDR.K
 13.2       4.3       -4.02        K.SALLPCGAR.-
Top scoring peptide matches to query 706
Elution from: 24.77 to 28.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 449109.5 FinneganScanNumber: 1496
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.7       3.3       -4.27        R.RTRLMVR.S
 11.4       6.9        1041        K.KKIDSTVR.L
 10.8         8        1080        K.ISQSTALAR.S
  9.9       9.8        1053        K.KLVTETAGK.E
  9.4        11        7.62        K.SLKAKMNR.R
  7.8        16        1060        K.VRAMLAASK.N
  7.7        16        15.4        K.VSSSGKRAR.E
  7.4        17        1075        -.MARGSLRR.L
  6.5        22        7.61        R.EMVKLRR.E
  6.3        23        1048        R.KVMASRVR.A
Top scoring peptide matches to query 707
Elution from: 34.46 to 38.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1383179.4 FinneganScanNumber: 2367
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.1         2        1063        K.KKIDSTVR.L
 10.8       4.3       -5.21        R.ILNVHVPR.L
  7.8       8.7        1074        R.HLHASLLR.S
  7.6         9        1052        K.SLSKRSLR.D
  7.0        10        1075        R.TVKAGTLEK.L
  6.8        11        1078        K.LSASTRRR.Y
  6.4        12        6.66        R.VYILVGQR.D
  6.0        13        1059        R.ISFLPLTR.L
  5.4        15        1052        K.VTRSKSLR.L
  5.3        15        1063        R.TQSLKTLR.N
Top scoring peptide matches to query 708
Elution from: 33.60 to 37.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2069618.6 FinneganScanNumber: 2282
Score greater than 27 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.4       1.9        1070        -.MKLSGVRR.V
 13.5       2.3        1070        R.KVMASRVR.A
 11.3       3.9        1074        R.HLHASLLR.S
 10.6       4.6        1062        R.KPFRSRR.L
 10.1       5.1        1059        K.LLFGDLLR.V
  9.2       6.2        1070        -.MARKVVSR.K
  7.4       9.4       -5.19        K.RVFRELK.M
  7.0        10        1075        K.SSIAKELAK.Y
  5.3        15       -5.19        K.LLFRDRK.L
  5.2        16       -5.19        R.FLAARTLR.S
Top scoring peptide matches to query 709
Elution from: 25.76 to 29.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1671262.2 FinneganScanNumber: 1588
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.6       1.1        13.8        R.RHSSLPPR.R
 17.1       1.5        1076        R.EHLLSPPR.S
 12.8       4.2        1076        R.KFLGSGSPR.S
 11.6       5.4        1054        R.SSTASLVKR.K
 11.1       6.1        1064        K.HQAVQLPR.E
 10.6       6.8        1049        R.YIVIDGLR.E
 10.6       6.8       -0.87        R.ALSLIYNR.D
 10.5         7        1054        R.VATSSKVTR.A
 10.5         7        1049        VGVISFAQK
 10.3       7.4        13.8        R.SLSPHRPR.H
Top scoring peptide matches to query 710
Elution from: 32.10 to 36.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 697129.6 FinneganScanNumber: 2143
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.5      0.79        1076        K.TNGKFLIR.A
 14.9       1.1       -1.28        R.SPIPAVIPR.E
 12.6       1.9        13.4        K.ALLSHRPR.E
 10.4       3.2        1076        R.RVYEILR.L
  9.4         4        9.16        R.KHLLWPR.H
  8.6       4.9      -13.12        R.RLLTPPPR.R
  8.2       5.3      -13.12        R.HIQLLGIR.G
  4.8        12        13.4        R.IHGPNKKR.I
  2.1        22      -13.12        R.KVPPQKPR.R
  2.1        22       -1.30        K.LGLVPTPPR.I
Top scoring peptide matches to query 711
Elution from: 25.81 to 29.81 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 605580.0 FinneganScanNumber: 1593
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.5       4.1        1057        K.TAVIGAVYR.K
 10.6       6.3        1072        R.SLSPHRPR.H
  9.5       8.2       -4.03        R.GLHKDKPR.G
  8.6        10        1057        R.ALSLIYNR.D
  7.9        12        1041        K.SRFWLLK.L
  7.6        13       -4.01        R.LYRQKSR.V
  7.6        13        1057        K.VGVAYVSVR.V
  7.1        14        7.80        K.AIAPTPGAPR.I
  7.0        15        1049        K.NFLAMLIK.L
  7.0        15        1045        R.QVPQKPPR.G
Top scoring peptide matches to query 712
Elution from: 34.44 to 38.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 654372.7 FinneganScanNumber: 2365
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.4       4.9        1055        R.NXITLTSR.N
 12.4         5        8.13        -.XELLDGIR.T
 12.1       5.4        1047        K.AFLKILSC.-
  9.2        10        1055        R.LVYDTKGR.F
  9.1        11        18.5        R.GHLFHVSR.V
  9.0        11        8.13        LNPTAPPSR
  8.5        12        8.14        K.KASQYLSR.S
  8.4        12        1055        K.LLSGDKYR.F
  7.7        15        1070        K.AMMKVISR.S
  7.6        15        1070        K.AMMKVISR.S
Top scoring peptide matches to query 713
Elution from: 34.55 to 38.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 654372.7 FinneganScanNumber: 2380
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.1       1.7        1070        K.AMMKVISR.S
 10.2       8.3        0.36        K.NFITKMAK.E
  9.2        10        1043        K.QPAVPAAAAR.A
  3.9        35        1055        R.LVYDTKGR.F
  3.3        40        1055        K.LRYDSAVK.V
  3.3        41        1067        K.NTSELLFK.K
  3.0        44        1043        R.SYLEKRR.E
  2.5        49       -3.69        K.IVHQDGKR.M
  2.5        49        8.13        DHKLPNTK
  2.1        53        1043        R.HTITIPNR.G
Top scoring peptide matches to query 714
Elution from: 41.56 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1838199.0 FinneganScanNumber: 3211
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 715
Elution from: 25.98 to 29.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10066620.6 FinneganScanNumber: 1615
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.0      0.64        1056        K.QSGGAGQYGK.V
 11.2       4.9        18.1        R.KSSEEAMR.E
  9.7       6.9        2.08        R.YSAMATGPR.W
  9.6       7.1        1064        K.DTKNMEAK.K
  8.9       8.2        1040        R.DSHPFPPR.D
  8.9       8.3        2.08        R.YALGMQDR.T
  8.6         9        1045        K.SSNESTLSK.S
  8.5       9.1        9.85        R.GRGSEEYR.A
  8.0        10        1075        M.CQGGDFIR.H
  7.8        11      -13.26        -.MSQCKKR.N
Top scoring peptide matches to query 716
Elution from: 16.89 to 20.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 520452.5 FinneganScanNumber: 865
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.7       1.7      -16.35        K.SMKGQTTGK.N
  9.4       7.3        2.30        K.GCKVMASGK.L
  7.2        12        5.84        K.MFQIDSGR.N
  6.6        14      -17.04        M.SDYWVVGK.K
  6.6        14       -9.48        -.MSQCKKR.N
  5.7        17        2.33        R.MNSAGMKSK.E
  5.6        18       -4.56        K.SMTVEVSGK.W
  5.4        18        1063        -.MAARCSTR.W
  5.4        18        5.82        K.VCFLSGDR.D
  4.7        22        1067        -.MRGGGFGDR.D
Top scoring peptide matches to query 717
Elution from: 16.87 to 20.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 520452.5 FinneganScanNumber: 863
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.1        12        1052        R.VWGTTCTK.H
  6.8        13        1068        K.QCETLSSK.L
  6.6        14        1072        K.QYLEDER.I
  6.1        16        1042        K.EESISLMK.E
  6.0        16        1060        R.YQDNREK.I
  5.7        17        1056        -.MSRSSPSGK.G
  5.7        17        1064        R.DEGMPIYK.A
  4.5        22        1068        R.SMQETVNK.L
  4.3        24        1037        R.MERLMTR.L
  4.2        24        1037        R.TSSGTSREK.T
Top scoring peptide matches to query 718
Elution from: 37.23 to 41.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 746870.5 FinneganScanNumber: 2803
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.0         6      -15.76        R.SVSYSILGK.Y
 10.4         7       -1.15        K.ASGPPKGPSR.A
  8.9       9.8        1071        K.TNPHEARK.R
  8.3        11        17.5        K.SHAHKMVK.W
  8.3        11        10.7        M.AELEHLGGK.R
  6.9        15        1057        K.NSFGILSSK.G
  6.3        18        1037        R.ASCKFIVK.V
  6.0        19        1045        K.HDRDIALL.-
  5.9        20       -1.16        R.TPGGQLPGAR.R
  5.5        21        1068        K.TDFEVLTK.V
Top scoring peptide matches to query 719
Elution from: 36.43 to 40.44 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4835209.6 FinneganScanNumber: 2666
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.7        12       -1.23        R.VADLVAGRR.Q
  6.8        14        1041        R.SERPVLVR.Q
  6.2        16      -15.79        K.GLSDPVKIK.N
  6.0        17      -12.96        R.RAELRGVR.R
  5.0        22        1056        R.GLRGSPGRR.L
  4.3        25        1064        R.VWRPLER.R
  4.3        26        1044        R.TRRGRPGR.R
  4.2        26      -15.81        K.VATPKVVDK.I
  4.1        27      -15.77        R.AAPEKIVTK.E
  4.0        27        1056        R.AAARTRGPR.R
Top scoring peptide matches to query 720
Elution from: 36.83 to 40.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4835209.6 FinneganScanNumber: 2735
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8       7.2        1068        K.IRLSHSSR.S
  6.1        17        1056        R.SVRGAGRPR.A
  5.5        19        10.5        R.QGLVVGLDR.N
  5.0        21        1041        K.SALGGGKLPR.G
  4.7        24        1056        R.RGLSGPGRR.T
  4.5        24        1053        R.SSPSPVILR.Q
  3.7        29        1068        R.ASRGPLGAAR.A
  1.0        55        1068        R.GAGRQPLTR.R
  0.8        56        1041        K.SVRIIDPR.R
  0.6        60        10.5        R.SGLLSGGLPR.K
Top scoring peptide matches to query 721
Elution from: 33.92 to 37.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 86815421.2 FinneganScanNumber: 2303
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.2        39      -15.69        R.IAVTLPESK.L
  3.6        45        1052        K.NLVEEPKK.R
  2.9        52        1067        R.SSLTQHKR.I
  1.9        66        1040        K.EKVPEAKR.L
  1.5        73       -1.12        K.NQVIKAER.R
  0.1        99      -15.69        K.DLLLEQVK.K
  0.1        99      -15.69        R.EVLLEVQK.H
Top scoring peptide matches to query 722
Elution from: 37.51 to 41.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 24205588.9 FinneganScanNumber: 2849
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.7       1.7        13.8        R.RSPRGATGR.K
 11.9       6.6       -0.75        K.SPKPSKSAR.S
  9.4        12        1063        R.FADVLVHR.L
  6.6        22        17.8        R.RIEPVMGR.L
  5.0        32        1053        R.SAPPGSLVTK.V
  4.6        36        1053        K.VPPNSTLTK.T
  3.3        48      -15.32        R.IIIXPDTSK.N
  2.1        63       -0.77        K.QAKAVEVGR.K
  1.8        67      -12.49        R.ERIERVR.R
  1.6        71       -0.75        K.NVIAALNSR.T
Top scoring peptide matches to query 723
Elution from: 34.24 to 38.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 86832973.5 FinneganScanNumber: 2337
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.4        37      -12.40        K.LKRSNSPR.G
  2.2        61        1067        R.KVSGSHVSR.S
  2.2        62      -12.42        M.SRLGALGGAR.A
  2.2        62        1041        R.TTLVPNVGR.A
  2.1        63        1041        R.LNSLPSLGR.E
  1.8        68        1041        R.SSKLHKEK.T
  1.6        71        1055        R.SGGAQRKPR.A
  1.5        72       -8.43        R.LMAVGVVPR.H
  1.1        80       -4.89        R.SWVLLPSR.V
  0.9        83        1041        K.LNEILQAR.G
Top scoring peptide matches to query 724
Elution from: 34.46 to 38.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 86832973.5 FinneganScanNumber: 2369
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.4       9.3        11.2        K.EVPSSAVLR.S
  6.6        22        11.2        K.SSLVPLDAR.E
  6.4        23        1041        R.NIVEAAAIR.D
  6.0        26        1041        K.LNEILQAR.G
  5.5        29      -12.27        R.AGRKGLEAR.L
  5.2        31       -0.55        K.LANNGTVLR.A
  4.8        33        1041        R.NLTVPGSLR.A
  4.6        35       -0.55        K.KVAQDQLR.D
  3.9        42        1041        K.SPKTPTGLR.R
  3.8        42        11.2        R.EGEQLLLR.F
Top scoring peptide matches to query 725
Elution from: 34.02 to 38.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 40475984.9 FinneganScanNumber: 2312
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1        35        1036        R.TLGGRGGRIA.-
  4.5        51        1060        K.EVPSSAVLR.S
  4.1        56        1055        R.MLKTRXR.T
  1.4     1e+02        19.4        K.IQISSASPR.N
  0.4   1.3e+02       -0.04        R.LVPMGSKAR.K
  0.1   1.4e+02        1063        R.DRAGGVRAR.A
Top scoring peptide matches to query 726
Elution from: 24.97 to 28.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 717743.8 FinneganScanNumber: 1519
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.3       4.6       -0.93        R.SLPGLASSVK.E
 13.8       5.2        13.6        K.QKERELR.L
 11.4       9.2        1066        K.DGIPISSLR.E
 10.1        12        17.6        K.LMESPLLR.Y
  9.3        15       -0.93        K.QQELLTVK.K
  9.1        16        1042        R.LAGRVQASR.F
  8.5        18        9.42        R.TWASPKLR.A
  8.1        19      -12.65        K.QTLSQLLR.V
  7.5        22      -12.65        R.GKASEVVLR.I
  7.4        23       -0.89        R.KLQELAEK.G
Top scoring peptide matches to query 727
Elution from: 22.99 to 26.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 566071.4 FinneganScanNumber: 1330
Score greater than 30 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 26.0      0.34       -8.87        K.MTILPEKK.H
 15.7       3.6        10.5        K.DPVLSTISK.S
 15.5       3.8       -1.18        K.TIVLSNGQK.E
 13.8       5.6      -12.92        K.NVVVTGRSK.I
 12.9         7        10.5        R.VITDPSLSK.T
 12.8         7       -8.87        K.TMLEKIPK.E
 10.5        12        1038        R.SQELIQLK.S
 10.0        14      -12.88        K.TLNRIQSK.L
  9.5        15       -8.92        -.MVSPVTVVK.S
  9.3        16       -1.15        K.ENTLNIKK.A
Top scoring peptide matches to query 728
Elution from: 37.23 to 41.20 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4555649.2 FinneganScanNumber: 2799
Score greater than 15 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1       8.8        10.6        R.LKESSLKR.R
  2.5        20        10.6        K.SKELSLKR.D
  1.7        24        1049        K.KSGVTIQVK.C
  0.9        29       -8.81        K.KLMLGVKR.L
  0.6        31        1049        K.TTVSLLAVR.S
  0.5        32       -5.29        R.GYKLPKVR.K
  0.5        32      -15.60        R.ELKTKLTK.L
  0.4        32        10.6        K.SKNTAAIKK.T
  0.0        35        6.38        R.LFLDVVVR.K
  0.0        36        1041        VGMLAVLLK
Top scoring peptide matches to query 729
Elution from: 37.16 to 41.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4770278.4 FinneganScanNumber: 2792
Score greater than 14 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.9       7.3      -17.00        K.IPPKRPPR.K
  0.7        30       -5.29        R.GYKLPKVR.K
  0.4        32        1059        R.RSFALLPR.L
Top scoring peptide matches to query 730
Elution from: 37.14 to 41.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4770278.4 FinneganScanNumber: 2789
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5        10        1049        K.KSGVTIQVK.C
  5.1        11        1049        K.SVPVSSKKK.E
  2.1        22        1041        K.MKLIVEVK.M
  1.4        26      -15.60        R.ELKTKLTK.L
  0.5        32        1059        R.RSFALLPR.L
  0.5        32        1063        K.SVGGRRSLK.V
Top scoring peptide matches to query 731
Elution from: 34.28 to 38.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1865655.0 FinneganScanNumber: 2343
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.8        42        1035        R.AAERSSALR.E
  4.6        55        1057        K.RGDGLTWR.D
  3.2        76       -9.76        K.SILNARCK.I
  1.7   1.1e+02        1065        -.MEVKGPSGR.S
  1.3   1.2e+02        1054        R.MATSRPAAR.E
  1.1   1.2e+02        1039        R.MELAILDR.L
  0.7   1.3e+02        1.92        K.IQDMVAIR.H
Top scoring peptide matches to query 732
Elution from: 20.48 to 24.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 262986.1 FinneganScanNumber: 1091
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.0        22        6.02        K.SILNARCK.I
  5.6        39      -12.49        K.RGLTGDSKK.A
  5.5        40        1039        K.VRSRGETR.E
  5.2        43        1063        K.TSTKTHSAK.K
  5.1        44        1065        R.GRSQGRSGR.S
  4.9        46        1043        R.IVEKMQGR.R
  4.3        52        1063        K.NNNLAVTSK.F
  4.3        53        1032        -.MSSVKRPR.G
  4.3        53        1065        K.LSFAHVMR.R
  3.9        58        1063        R.LSRSDPSAK.Y
Top scoring peptide matches to query 733
Elution from: 30.80 to 34.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 697035.0 FinneganScanNumber: 2025
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.1       1.8       -1.07        K.VGIVFTDGR.S
 18.1       1.8       -1.07        R.VGLVFTDGR.S
 14.5       4.1        3.16        R.SKQSKTER.E
 12.6       6.4        1050        K.SKSPTISDK.T
 11.6       8.1        17.6        K.SQSRSRSR.S
 11.3       8.5       -1.04        K.SYLPQTVR.Q
 11.1         9        1057        R.LVSLSACGR.T
  9.5        13       -1.03        R.FAQLELSR.A
  9.5        13        1037        K.LCMLAKAR.E
  9.4        13        14.8        R.SQQSVSLSK.S
Top scoring peptide matches to query 734
Elution from: 34.44 to 38.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 677299.6 FinneganScanNumber: 2366
Score greater than 23 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.5       2.4        1036        R.RAPLPRPR.A
  9.4       3.1        1048        R.GLPVRPAPR.R
  7.1       5.4        1063        R.RLQRHPR.S
  6.1       6.7        8.82        K.KRLFFPR.F
  6.0       6.9        1048        R.AAGHLLKPR.A
  6.0       6.9        1060        K.KATVYKPR.E
  4.7       9.4        1048        K.RAAFTKLR.R
  4.3        10        1048        R.VRKGFSLR.N
  3.4        13        5.33        K.RLMIKFR.G
  1.0        22        1048        M.IVRPPQPR.G
Top scoring peptide matches to query 735
Elution from: 34.36 to 38.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 662349.4 FinneganScanNumber: 2353
Score greater than 16 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.1        11        1060        K.RLLNTFAK.V
  3.5        12        1036        R.LPPARRPR.E
  3.5        12        1048        R.AAGHLLKPR.A
  2.5        16        1060        R.KFVGEVKR.C
  2.4        16       -1.47        R.TLPPPGILR.T
  1.4        20        1048        R.VRKGFSLR.N
  1.0        22        8.82        K.KRLFFPR.F
  0.5        24        1048        R.AAFTKLRR.A
Top scoring peptide matches to query 736
Elution from: 30.84 to 34.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 327896.3 FinneganScanNumber: 2029
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.0       3.5        1030        R.YGAEIVRR.Y
 14.8       3.6        17.8        R.TVAHHFPR.L
 14.2       4.2        1030        K.YGAEVRLR.R
 14.0       4.3        1048        K.LVRCYPR.K
 10.4       9.9        1030        R.IYDRLQR.I
  9.5        12        15.7        K.ITLMDVTR.N
  9.4        12       -4.07        K.GYAIQRTR.L
  8.2        17        1030        K.IYRGEAVR.K
  8.2        17        1042        R.LFTEAVQR.Q
  8.1        17      -11.73        K.XLKKYPR.L
Top scoring peptide matches to query 737
Elution from: 26.95 to 30.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1499269.1 FinneganScanNumber: 1709
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.8       3.4        1033        K.SQGPQVPPR.F
 14.0         4      -18.36        R.RCAPPLPR.D
 12.8       5.3        1051        R.MGRLGYPR.W
 10.3       9.3        1037        R.TLGPVMYGK.L
 10.3       9.5        1033        R.SPSLRYSR.K
 10.2       9.7        12.6        R.EVPNSAPPR.Y
 10.0        10        12.6        K.DSELHLPR.V
  9.9        10       -3.25        R.GPIWGPSPR.V
  9.4        12        1033        R.AMMEKLVK.S
  9.3        12        1044        R.TTTFKDPR.N
Top scoring peptide matches to query 738
Elution from: 26.95 to 30.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1499269.1 FinneganScanNumber: 1708
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.2       3.1        1044        R.TVAVAEYGR.C
 13.4       4.7        1021        K.RPNPAPGTR.K
 12.5       5.6      -18.36        R.RCAPPLPR.D
 11.5       7.2        19.3        K.HGAPRPGMK.S
 11.5       7.2      -10.71        R.RAAPTXGTR.A
 11.2       7.6        7.69        R.RHMLTHR.G
 11.0         8        0.95        R.RGYKASER.R
 10.7       8.5        11.2        K.RSXQHPR.V
  9.4        12        1029        K.WLSIAYGR.C
  9.3        12        1033        R.DPPGQAKPR.G
Top scoring peptide matches to query 739
Elution from: 37.58 to 41.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1160492.2 FinneganScanNumber: 2858
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.6        31        7.26        -.MSTSLSLGR.S
  4.6        31        10.8        R.SHEDPAALK.F
  4.5        32        1026        -.MAVASTKSR.W
  4.3        34        7.27        K.KMGSAKDSK.G
  4.2        35        1022        K.MVEVVAFR.A
  4.1        36        14.0        K.KSMNGRMK.Q
  3.9        37        1038        M.MSIQEKSK.E
  3.9        37        1042        K.GFEKDVGSK.T
  3.7        38        1057        -.MPLLSSMR.G
  3.5        40        1042        M.SGGTPYIGSK.I
Top scoring peptide matches to query 740
Elution from: 37.47 to 41.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1160492.2 FinneganScanNumber: 2846
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.2       3.5        1040        K.EHPPPHPR.S
  8.5        13       -5.02        K.EGPRAFYK.G
  7.5        16        1030        R.GPSPPASPTR.K
  7.5        16        9.33        R.GGFGGRGGFR.G
  7.4        17        1030        R.SLYNLGGSR.S
  7.0        18        1038        K.VNTGLMTSK.K
  6.7        20        1030        R.EVPNSAPPR.Y
  6.3        21        7.26        -.MSTSLSLGR.S
  6.2        22      -16.68        K.TPHTWLGR.V
  6.1        22      -16.66        R.HIPSFNPR.G
Top scoring peptide matches to query 741
Elution from: 29.23 to 33.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3822812.7 FinneganScanNumber: 1894
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 41.2    0.0069       -1.30    1   IPI00301263 K.VPQFSFSR.L
 23.9      0.38      -12.90                    -.XNGAWPPAR.R
 15.0       2.9        14.5                    R.SSSFSLPSR.A
 12.3       5.3      -16.37                    K.SHMHAKIK.A
  9.9       9.3        1057                    R.VIEFSEDK.V
  8.0        14       -8.24                    K.SSVMKKCK.A
  7.0        18        1026                    R.MLNQGFLK.V
  6.7        20       -1.30                    R.NVFDGIFR.N
  6.5        21        2.90                    K.SYAIRDSR.Q
  5.0        29        1049                    -.MKMANSLR.G
Top scoring peptide matches to query 742
Elution from: 29.31 to 33.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3822812.7 FinneganScanNumber: 1900
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 43.7    0.0039       -1.30    1   IPI00301263 K.VPQFSFSR.L
 17.5       1.6        14.5                    R.SSSFSLPSR.A
 14.9         3        1026                    K.MLANIFNK.D
 14.9         3        1026                    R.MLNQGFLK.V
 10.7       7.8        1042                    K.EKQMSSLK.E
 10.2       8.7      -12.90                    -.XNGAWPPAR.R
  9.2        11        1049                    R.KMTTAMAGR.K
  8.3        14       -4.75                    MIKFQER
  7.7        16        6.85                    R.QAVMDFIK.D
  7.6        16       -4.75                    K.NKLGMFNK.I
Top scoring peptide matches to query 743
Elution from: 25.91 to 29.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1034119.8 FinneganScanNumber: 1605
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1        12       -3.02        K.VGMIPAPKR.V
  4.8        16        1053        -.MVRPALHK.Q
  4.5        17        16.2        R.AVLGAPDVAR.V
  3.8        20        4.61        R.SVLTKHQR.I
  3.6        21        1034        K.GPGDLKPKR.G
  3.0        24        1056        R.LPKWGGPGR.R
  2.6        27        16.2        R.DPATAPLRK.L
  2.3        28        12.1        R.LSYFLGLR.D
  1.9        31        1049        R.GPQTRPRR.S
  1.9        31        19.0        R.RQRAGPGAR.G
Top scoring peptide matches to query 744
Elution from: 25.89 to 29.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1034119.8 FinneganScanNumber: 1601
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.8         2        4.63        R.GLRGLEAPR.V
  5.1        15        1046        K.DGKPVQPVK.R
  5.0        15        1049        K.RGSRAPPAR.T
  4.5        17       -6.98        R.RAGNAVKPR.G
  3.5        22        1034        R.QVAPVAGVAR.K
  2.9        25        1056        R.WPGKVPAGR.L
  2.3        29        16.2        R.DPATAPLRK.L
  2.0        31       -9.77        R.AKTVPVPEK.W
  2.0        31        4.63        K.KRVPEPSR.R
  2.0        31        0.46        R.RKVAGYFK.K
Top scoring peptide matches to query 745
Elution from: 36.64 to 40.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1199984.8 FinneganScanNumber: 2702
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.7        18        10.4        K.SSKKAEPVK.V
  7.1        20       -1.12        K.VGEGSKIRK.F
  6.4        24        1049        K.KAQSASPKR.K
  5.1        32        1049        R.AQTLQKQR.R
  4.6        36        1042        K.RIQAMIPK.G
  4.2        39        17.1        K.GPMKLGARK.L
  1.9        66       -1.12        K.LDSVKQRK.V
  1.6        71       -8.71        K.SMLALLLGR.T
  0.3        96       -1.13        K.ITKTVQQR.Y
  0.2        99        1023        K.VVLTGAKER.S
Top scoring peptide matches to query 746
Elution from: 34.28 to 38.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19969703.2 FinneganScanNumber: 2345
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.0       6.6        1033        R.RLVITTSPS.-
 11.7       7.2        16.8        R.QRMALLAR.K
  9.2        13        10.0        K.KTLEQTVR.E
  8.8        14       -1.49        R.RSSEKLVR.K
  8.3        15        1018        R.KWLNALTK.R
  8.0        17        10.0        R.VTNSSVIVR.V
  7.6        18        1022        R.LLISTDRR.S
  7.4        19        5.91        K.FALKSPPSK.N
  7.1        20        1040        R.RVAVLGCAK.M
  7.1        21        1033        R.RVLTDELK.H
Top scoring peptide matches to query 747
Elution from: 34.20 to 38.17 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19969703.2 FinneganScanNumber: 2331
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 16.6       2.3        1033                    R.EDLSKIIR.T
 14.2       3.9        1048                    R.SRSPATAKR.G
 13.9       4.2        1022                    M.SGASVKVAVR.V
 13.2       4.9        1048                    K.SSQAVRAVR.D
 13.2         5        1022                    M.ITKTQVQR.Q
 13.1         5        1048   24   IPI00790962 RGTLAGGSVR
 12.7       5.6        1022                    R.NSKLKDIR.N
 11.6       7.2        1048                    R.SRLSLGAGGR.A
 11.5       7.3        1036                    R.LRSASGARR.R
 10.9       8.3       -1.46                    R.TRTAVTGLR.S
Top scoring peptide matches to query 748
Elution from: 35.04 to 39.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19969703.2 FinneganScanNumber: 2434
Score greater than 30 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.5       1.1       -1.27        R.RAVSTATLR.S
 16.4       2.3        1018        R.VTQPFILR.R
 15.3         3        1048        K.RVENTAKR.K
 13.1         5        1045        -.XSVVIVDVK.E
 12.8       5.4      -12.80        R.RSRTLVSR.L
 12.8       5.4        1048        K.DKGRTLQR.T
 12.7       5.5        10.3        R.RKESIDVK.S
 12.6       5.6        17.0        R.RSAAVLMAR.H
 12.5       5.7        1048        R.TQAVVSGRR.S
 12.2       6.1        1022        R.KASVTIQAR.A
Top scoring peptide matches to query 749
Elution from: 35.25 to 39.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19969703.2 FinneganScanNumber: 2467
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.4       2.3        1048        K.SSKPDRKR.A
 13.4       4.7        1048        R.LRSNSIGAR.H
 11.2       7.7        1022        K.LSAQASLKR.H
 10.7       8.6        1048        -.XAGLAAARTR.V
 10.6       8.8        17.0        R.LLGASAMRR.S
 10.2       9.7        1040        K.GPMKLGARK.L
  7.9        16        17.0        -.MAVALGTRR.R
  7.8        17        17.0        K.VAMNGKARK.E
  7.7        17        1018        R.YLLLAGAPR.E
  7.6        18        1022        K.ATKARLADK.N
Top scoring peptide matches to query 750
Elution from: 29.97 to 33.96 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 707049.2 FinneganScanNumber: 1954
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.2       5.5      -12.49        K.ALDSITSIR.E
 10.5        13        1017        K.LSVVAAAMGR.K
 10.2        14        1013        K.GGKRSLSNR.L
  9.1        18        1046        K.SQRPFSPR.E
  9.0        18        1036        R.DKLIQDSR.R
  9.0        18        1024        R.KINNQTTR.C
  7.3        27      -13.85        R.AQRIAFNR.E
  7.1        28        1036        K.EKEVLSNR.C
  6.3        34        13.3        R.NASLSQSLR.V
  6.0        37        1038        K.SKWGMIPR.G
Top scoring peptide matches to query 751
Elution from: 19.71 to 23.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 399715.9 FinneganScanNumber: 1040
Score greater than 27 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.9       4.7      -12.84        R.KTSNKELR.H
 13.6       6.3       -6.16        K.RMNKLGTR.L
 12.7       7.7        8.81        R.EVGAIHPPR.A
 11.8       9.5      -12.88        KVSTSGQIR
 11.8       9.5      -10.29        -.XAVMWRKK.S
 11.7       9.7        1028        R.KTLSCPLR.H
  9.7        15      -12.84        K.KTENSKLR.K
  9.7        15       -1.34        R.KTTDLEIR.E
  8.8        19       -1.31        R.KESLENKK.N
  8.6        20        16.9        R.QMEVISLR.L
Top scoring peptide matches to query 752
Elution from: 21.88 to 25.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1574059.8 FinneganScanNumber: 1213
Score greater than 13 indicates homology
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.8       5.4        17.0        K.DDAMSEHR.R
Top scoring peptide matches to query 753
Elution from: 41.18 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 20372232.0 FinneganScanNumber: 3174
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.7        35        1038        R.NWEGDDIK.T
  0.1        51        1019        R.YREMSYK.V
Top scoring peptide matches to query 754
Elution from: 38.86 to 42.84 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1070731.4 FinneganScanNumber: 3006
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.2       4.6        1027        R.LGAFITKVK.K
  4.1       5.9        1015        K.VYLGIRKK.L
  0.7        13        6.38        K.TIVTRFLK.L
Top scoring peptide matches to query 755
Elution from: 38.86 to 42.84 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1070731.4 FinneganScanNumber: 3007
Score greater than 19 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.5       2.7        1041        K.KIRYQLR.M
  7.3       2.8        1041        K.YLRQKLR.A
  6.3       3.6        1041        R.AVPIPARPR.K
  5.3       4.5        1029        -.RIGKPHLR.S
  2.6       8.2        1041        M.RKLLSFGR.R
  2.5       8.4        1041        R.LFRKIGSR.S
  2.5       8.5        1015        K.KAVYIKVR.V
  2.5       8.6        1041        R.LFRVASKR.H
  2.3       8.9        1041        R.HTKLKPPR.T
  1.9       9.8        17.9        K.ISIYQIIK.E
Top scoring peptide matches to query 756
Elution from: 41.18 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2812047.0 FinneganScanNumber: 3175
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 757
Elution from: 35.21 to 39.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1881649.9 FinneganScanNumber: 2463
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8        19      -14.95        K.MLSVKVMR.D
  7.2        22        1040        K.NHPGVAEVR.S
  5.8        30        1044        SRSTSRER
  5.1        35        1040        R.DAAIMKMAK.E
  4.9        37        19.0        R.AFEVLDSAK.R
  4.5        40        1040        R.FNSLGERR.E
  4.4        41        1014        K.VYDKAINR.K
  4.2        43        1011        K.KMSLKSER.R
  3.8        48        1040        K.NPHQVDLR.T
  3.7        49       -3.96        R.THLAPGVER.Q
Top scoring peptide matches to query 758
Elution from: 35.16 to 39.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1881649.9 FinneganScanNumber: 2453
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.8         6        1036        R.GFFQGGIPR.A
 12.1         7       -7.37        -.MTRASKSAK.M
 11.7       7.7        1044        K.SSRRSSGGGK.R
  9.8        12        1018        K.SSSVTVRSR.K
  8.0        18        1025        -.MSARVRSR.S
  6.9        23        1014        K.TFGQAVSLR.R
  5.5        32        1018        K.SKKGQSTSR.H
  4.1        44        1029        K.KCIMLASR.H
  4.0        45        1036        -.MSGRGKTGGK.A
  3.9        46        1014        R.VGNYLIGSR.K
Top scoring peptide matches to query 759
Elution from: 35.10 to 39.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1881649.9 FinneganScanNumber: 2444
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 23.2      0.55        1036        K.RATGSTVMR.R
 18.9       1.5        1014        K.TFGQAVSLR.R
 17.4       2.1        1014        K.VYDKAINR.K
 12.2       6.8        1014        R.VGPPSTPAPR.K
 10.5        10        7.54        R.GYGETALLR.A
 10.3        11        1036        R.RTMTNALR.K
 10.0        11        1014        K.NLKDVSFR.L
  9.3        13        1021        RAVVACFR
  9.2        14        1014        K.AFSNLSALR.K
  8.2        17        1040        K.RNFEKER.K
Top scoring peptide matches to query 760
Elution from: 27.90 to 31.88 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1255729.0 FinneganScanNumber: 1785
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.2       2.3       -4.38        R.NVNPVALPR.A
  8.4        11        7.11        K.LLLSYGASR.N
  8.2        11        1016        R.HPSLRRGR.R
  7.6        13        1014        R.GLQLTPPPR.R
  7.4        14        1028        R.EPPRPARR.F
  7.4        14        17.2        R.AIHWSLPR.A
  7.2        15        1014        K.LGSKYVVGR.A
  4.4        28      -15.87        R.LGPRPGGLGR.S
  4.0        30        1039        K.KQPAHLER.L
  4.0        30        1039        K.LTHGGPLQR.R
Top scoring peptide matches to query 761
Elution from: 22.30 to 26.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 623518.4 FinneganScanNumber: 1256
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 49.3     0.001       -1.34    1   IPI00301263 R.FLSSAAAVSK.E
 34.6     0.031        1016   27   IPI00007675 K.FSLDAVSLK.D
 23.6      0.38        5.32                    R.FLNTRAMK.E
 23.6      0.38        1038                    R.KMEKVSNK.T
 23.6      0.38        1019                    K.MLSVKVMR.D
 23.6      0.38        16.8                    K.MTVFPKNK.S
 16.6       1.9        1038                    K.SMLERLSK.F
 16.2       2.1        1016                    K.GVFITDSLK.Q
 13.7       3.8        1022                    R.MPPQHIIK.G
 13.7       3.8        13.3                    R.TCAKLMKL.-
Top scoring peptide matches to query 762
Elution from: 22.28 to 26.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 623518.4 FinneganScanNumber: 1254
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.4       2.6        1041        R.NYQKDLAK.L
 14.4       3.2        1041        R.GYGETALLR.A
 13.4         4        2.77        K.SSSSGKKTAK.T
 11.6       6.1        1030        R.HIALSGPER.Q
  9.8       9.3       -1.34        K.SFITSIANK.N
  9.1        11       -1.36        K.LFTTSGNLK.R
  8.4        13        1.21        R.MFQKWIK.A
  8.1        14        1016        K.GVFITDSLK.Q
  7.0        18        13.3        R.TCAKLMKL.-
  6.8        18      -16.91        K.YNKPAFLK.N
Top scoring peptide matches to query 763
Elution from: 30.42 to 34.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 907247.3 FinneganScanNumber: 1990
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.2       3.1        1040        R.SSIKISAFK.C
  8.2       5.1        1018        R.VGRPVLSPR.T
  7.7       5.6       -1.20        LPVPLESVK
  6.2         8        1040        R.SVKLKDYK.L
  5.9       8.5        1.56        R.ARPKVPASR.F
  5.9       8.5        1032        -.XRHVSVRR.F
  5.6       9.1        13.0        R.ARSPPQVVK.S
  5.3       9.8        1043        R.SAIIQHRR.I
  5.0        11        1043        K.THQVIARR.Q
  4.9        11        16.9        K.VMFTKVLK.A
Top scoring peptide matches to query 764
Elution from: 28.13 to 32.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2128864.4 FinneganScanNumber: 1808
Score greater than 24 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.4       3.1        1008        R.ARPKVPASR.F
 10.6       3.8        1008        R.RIAQQLPR.Q
  9.5       4.8        1008        R.VVRGPQLGR.L
  5.5        12       -7.12        R.LPRRGLDR.E
  5.3        13        1008        R.NRIPLNVR.D
  5.2        13        1008        ASRPGKPLR
  4.5        15        1008        R.HITVRLSR.H
  4.0        17        15.7        R.TGGSLVAHIK.V
  2.9        22        1015        R.LPWPLLSR.Q
  2.8        23        1008        K.LNNVRLPR.E
Top scoring peptide matches to query 765
Elution from: 28.17 to 32.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2128864.4 FinneganScanNumber: 1811
Score greater than 19 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.0       1.7        1008        K.RKVVNTHK.L
  5.5        12        1034        M.PRPASARAR.C
  5.1        13        1008        R.VVRGPQLGR.L
  4.8        14        4.32        R.RTAAPTPIR.F
  3.9        17        1034        K.KRAHSLNR.Y
  3.9        17       -3.22        R.LVCLKPPR.R
  3.7        19        1034        K.KSHNLRAR.L
  2.3        26       -7.12        R.RDVLPRAR.V
  1.9        28        1019        R.TPSPAPKRK.K
  1.7        29        15.7        K.VTPAPTLQR.D
Top scoring peptide matches to query 766
Elution from: 30.44 to 34.44 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1263672.1 FinneganScanNumber: 1992
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.4      0.16        1011        K.IPVNIVAQK.S
 14.3         1        1022        LPVPLESVK
  9.6         3        1037        M.PLQGLGLQR.N
  6.0       6.8        17.5        K.LPLSFLHR.A
  2.6        15        17.5        R.VLYIRYR.H
  1.2        21        1040        K.KAVLIMYK.V
  0.7        23        1011        R.VIPKVSNPK.S
  0.0        27        1040        -.MSKFLVLK.W
  0.0        27        6.03        R.LPPIHLHR.M
Top scoring peptide matches to query 767
Elution from: 23.12 to 27.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 581128.4 FinneganScanNumber: 1337
Score greater than 29 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.4         1        1008        R.HLPSVCGGR.F
 15.6       1.9        1019        -.MGLTAYGNR.R
 14.8       2.3       -1.52        R.SFTAVSTDR.R
 14.1       2.7        8.58        K.QFQYQNR.I
 14.1       2.7        1027        R.DTMSLMIR.Q
 14.1       2.7        1019        -.MEPAGPAPGR.L
 11.9       4.5        5.16        K.QAMKNYGR.K
 11.5       4.9        16.6        -.MFGTSGDLR.N
 11.5       4.9        1016        R.KMTTAMAGR.K
 10.8       5.8        1016        -.MKMANSLR.G
Top scoring peptide matches to query 768
Elution from: 37.12 to 41.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7442948.8 FinneganScanNumber: 2781
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.9        29       -5.58        R.RMHVLRR.R
  2.0        36        1039        R.DITGARPPR.G
Top scoring peptide matches to query 769
Elution from: 36.75 to 40.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7442948.8 FinneganScanNumber: 2721
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.9       2.9        10.6        R.LDSSLPPVR.R
 12.6       3.2        1027        K.SPTKRTHR.K
 12.3       3.4        1039        R.QVVKTDHR.Q
 12.1       3.5        1009        R.SVFLTFLR.M
 10.7       4.9        1035        K.KSGFQIFR.E
  9.8         6       -0.78        R.SILTEHKR.I
  9.1         7      -12.22        -.GSVAAPRVAR.A
  8.7       7.8        1031        K.SPMLLLHR.R
  8.4       8.3       -0.81        K.IAGPGLGSGVR.A
  8.0         9      -12.19        R.RAALSPAAAR.R
Top scoring peptide matches to query 770
Elution from: 36.79 to 40.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7442948.8 FinneganScanNumber: 2725
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.8       4.7        17.3        K.HGLKMLER.S
  9.0       7.2        1035        K.LPPGWEKR.M
  7.3        11        1013        R.IPPSTPRSK.R
  5.1        18        1039        R.GDIEHKKR.K
  4.0        23        1039        R.LLHAAQSSR.E
  3.2        27        1039        K.LPPDTRQR.I
  1.3        42        10.7        R.VPEAVALER.R
  1.2        44        17.3        R.VAMAXALVR.N
Top scoring peptide matches to query 771
Elution from: 36.72 to 40.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7442948.8 FinneganScanNumber: 2712
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.3       1.1       -8.30        R.LLSCLLHK.A
  9.5       6.4       -0.77        M.ASSPIQPRK.G
  7.7       9.7       -0.77        K.STLERIHK.H
  6.8        12      -12.20        R.LERPGQRK.Q
  6.6        12      -12.20        K.RLDPAQRK.L
  6.2        14        10.7        R.LSALLSHDK.L
  6.2        14      -16.32        R.LFVPHSKR.V
  6.1        14       -0.77        K.VPGNEARLK.A
  6.1        14      -19.73        R.MVSIIHRK.F
  6.0        14       -0.77        R.HRETLSLK.Q
Top scoring peptide matches to query 772
Elution from: 34.67 to 38.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1561406.3 FinneganScanNumber: 2395
Score greater than 28 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.3       1.4        1018        K.MKYSIVSR.N
 16.5       1.7        1022        R.IFTNLYGR.H
 14.3       2.9        1037        K.HEENLTIK.K
 13.2       3.7        1.37        R.LFTLGFMR.C
 11.7       5.2        5.47        K.VTNCLHIK.R
  9.3       8.9        16.9        KMTDYAKK
  7.4        14       -1.17        R.AGLGVEPVDK.D
  6.6        17        13.0        R.GTSAGHLVSR.V
  6.5        17        13.0        K.TRENSHLK.T
  6.5        17        1018        R.GIPQLPCAK.A
Top scoring peptide matches to query 773
Elution from: 34.62 to 38.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1534681.0 FinneganScanNumber: 2387
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.7       4.1        1003        R.RPGTRSGPR.A
  9.8       8.1        1.59        K.DRPNAAGRK.R
  9.7       8.1        1022        R.IFTNLYGR.H
  8.8        10        16.9        K.NSVKVMYK.C
  8.7        10        13.0        R.NSPNGNLIR.M
  6.7        16      -12.57        K.TSPALPRDK.V
  6.3        18        1021        K.CGKGIRHR.T
  5.9        20        13.0        K.REAIPGEGR.K
  5.7        21        1026        R.NQNLLEPR.Q
  4.6        26        5.47        K.LDMVTLHR.F
Top scoring peptide matches to query 774
Elution from: 25.54 to 29.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 960165.3 FinneganScanNumber: 1572
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 30.9     0.038        10.6                    -.MSTVICMK.Q
 18.1      0.72       -0.59    1   IPI00301263 R.SFEEAFQK.A
 17.4      0.85        14.0                    K.AVEFMNMK.K
 17.4      0.85        1012                    -.MTTDSAKSK.L
 16.7         1       -4.00                    K.YAMEQSIK.S
 15.9       1.2        1027                    K.TTDDLEYK.L
 15.1       1.5        1030                    -.MSEVSCKK.R
 12.5       2.6        1030                    K.CAMTALSSK.L
 12.4       2.7        1019                    K.MXSRLSSK.A
 11.5       3.3       -4.01                    K.FQSLMSEK.D
Top scoring peptide matches to query 775
Elution from: 25.55 to 29.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 960165.3 FinneganScanNumber: 1575
Score greater than 28 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 25.8      0.12       -0.59    1   IPI00301263 R.SFEEAFQK.A
 13.9       1.9       -4.01                    K.FQSLMSEK.D
 10.6         4        1004                    R.STSSSNVFR.R
 10.4       4.2        1030                    K.ESGSPGHSAR.V
 10.4       4.2        10.1                    -.MSHAAEPAR.D
  9.8       4.8        14.0                    MVDMSFQK
  9.8       4.9        14.0                    R.TWMEKMK.V
  9.5       5.3      -15.44                    R.CGGKYSVSK.D
  9.2       5.6      -15.44                    M.AMSGSLTFR.D
  8.3         7      -15.44                    K.STFINMTR.V
Top scoring peptide matches to query 776
Elution from: 27.01 to 31.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 697410.2 FinneganScanNumber: 1716
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.8      0.29      -12.73        K.IQKDLKIK.A
 16.8      0.92      -12.72        R.KELILKNK.V
 16.3         1       -1.31        R.EELLLLKK.E
 16.2         1        12.8        K.EKARAVLAK.V
 13.4         2        12.8        K.RQLTVQLK.S
 11.8       2.9        12.8        K.QQILISRK.H
 10.9       3.6        12.8        R.EKALRLQK.E
 10.8       3.7       -1.31        K.IKEILELK.A
 10.7       3.7        12.8        K.AQRELKLK.D
 10.7       3.7        12.8        K.AVAELKARK.R
Top scoring peptide matches to query 777
Elution from: 26.97 to 30.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 697410.2 FinneganScanNumber: 1710
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 28.4     0.063       -1.31    1   IPI00301263 R.KEEILLIK.A
 26.5     0.099      -12.72                    R.KLKNELLK.Y
 25.9      0.11        12.8                    R.KQNLKNLK.S
 20.6      0.38        12.8                    K.AVAELKARK.R
 19.0      0.56       -1.31                    K.KLEELLIK.T
 17.4      0.81      -12.72                    R.KELILKNK.V
 15.7       1.2        12.8                    ARKQEIIK
 15.7       1.2        12.8                    K.GKIKGQNLK.L
 15.7       1.2      -12.73                    -.XILREILK.G
 15.6       1.2       -1.31                    K.IKEILELK.A
Top scoring peptide matches to query 778
Elution from: 25.95 to 29.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 678707.0 FinneganScanNumber: 1609
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.4       6.3        1023        K.LERPRTSK.G
 12.3       6.5        1011        K.QRKASIQR.K
  9.8        12       -1.33        K.QAGEIKTLK.E
  8.5        16       -1.33        K.ESVNAKVLK.D
  7.8        18        1027        R.KMELIQPK.E
  7.3        21        1011        R.RVRASELR.S
  6.6        24        1034        K.KSPEIISGR.M
  6.5        24        1034        R.QKDLAAAAAK.L
  6.5        25        1023        KNAQLEKR
  6.5        25       -1.33        R.LNKISDGLK.E
Top scoring peptide matches to query 779
Elution from: 26.01 to 30.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 678707.0 FinneganScanNumber: 1616
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.4       5.1        1023        R.LSDRGGLLR.L
 12.8       5.7      -12.71        -.XEQIKRVK.D
 12.0         7      -12.73        K.ATRKDVAVK.F
 11.8       7.2       -1.35        R.TGLLSVELR.V
 10.6       9.5       -1.35        R.TVAVLSELR.S
 10.5       9.8      -12.71        R.KSRIDQLK.R
  9.9        11        1019        R.SRLWLPSK.S
  9.7        12        1034        KAASGEAKPK
  8.8        15        1034        R.GDAATIVALR.T
  8.3        16        12.8        R.TVSQRQLR.V
Top scoring peptide matches to query 780
Elution from: 37.33 to 41.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11162423.2 FinneganScanNumber: 2820
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.7        31        1009        K.NLGNIKVTK.M
  2.7        49        1009        K.LQTAAKLNK.H
  2.4        53        1035        R.LDADRKIR.L
  2.3        54        1035        R.RPGSSLTRL.-
  2.2        56        1035        K.REKAQINK.T
  2.1        56        1023        K.QNATRKIR.L
  2.1        56       -4.87        R.GWGVKTLVK.I
  0.1        91       -0.74        R.LESKLNRK.V
  0.0        91        1009        R.LLREKEAK.I
Top scoring peptide matches to query 781
Elution from: 37.33 to 41.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11162423.2 FinneganScanNumber: 2817
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.2        11        10.6        R.NKATAEILK.A
  6.9        19        1020        -.XSVVIVDVK.E
  6.8        19        1035        R.DEGLRLRK.V
  6.2        22       -0.75        R.KLRSDIQK.R
  5.2        28        1009        K.LQTAAKLNK.H
  5.1        29        1020        K.LELQKLDK.S
  4.9        30        10.6        K.GKVEAEKVK.R
  4.3        34       -8.24        -.MNQLLLKK.G
  2.0        58        10.6        K.DGVIQTKVK.H
  1.5        65        10.6        R.VGKEGEKLK.E
Top scoring peptide matches to query 782
Elution from: 37.39 to 41.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11162423.2 FinneganScanNumber: 2828
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
  7.3        17       -4.85                    K.LKKFITTH.-
  5.6        25        1035    9   IPI00029446 K.GPSLRTLSR.N
  2.3        54        1009                    K.LQTAAKLNK.H
Top scoring peptide matches to query 783
Elution from: 34.31 to 38.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5936562.1 FinneganScanNumber: 2350
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       2.5        1018        R.MWKILXK.F
 12.1       2.5        1018        K.WMIKIRK.R
  9.1         5        1034        K.MKLLINSR.V
  8.0       6.3        1034        K.DALKKLMR.F
  7.7       6.9        1026        M.RPPSPLPAR.W
  7.0         8        1012        K.VTILELFR.S
  6.2       9.5        1034        K.DMLKALRK.L
  5.6        11        1034        K.EVKMALRK.V
  5.5        11        1008        K.TMLASLKVK.K
  4.9        13        1012        K.LITVNFVGK.D
Top scoring peptide matches to query 784
Elution from: 35.18 to 39.17 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3983338.5 FinneganScanNumber: 2456
Score greater than 20 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.2       0.7       -5.09        K.KSFNKIVR.I
  6.7       7.8        6.25        K.KSFEILVR.K
  6.6         8       -5.09        K.RFQATKIK.T
  6.5       8.2        1027        K.ESSVLSKLK.F
  6.3       8.6      -16.43        K.RLLHLPSR.S
  4.6        13        1001        K.YLAAVLGKR.Y
  4.2        14        6.25        K.LPPLPAVER.V
  4.0        15        1001        R.FIKLGGLSR.G
  3.5        16        6.26        K.QKKEAFLK.C
  2.7        19        6.25        K.FNKITAVAK.G
Top scoring peptide matches to query 785
Elution from: 35.04 to 39.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3983338.5 FinneganScanNumber: 2435
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.8       7.6        1026        R.SLFRQALR.L
  5.7       9.8       -5.09        K.KSFNKIVR.I
  5.5        10      -19.17        R.TLFLLGVTK.Y
  4.7        12        6.26        K.QKKEAFLK.C
  2.1        23        6.23        R.LHVLGPDLK.S
  1.6        25        1026        M.FLKAGRGNK.V
  1.2        27        1001        K.QVIFRTVK.E
  0.9        29        6.25        K.KSFEILVR.K
  0.9        29        6.23        K.ILKTFVDR.K
  0.8        30        1001        R.IFNLRSLK.L
Top scoring peptide matches to query 786
Elution from: 35.70 to 39.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1020930.3 FinneganScanNumber: 2540
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 787
Elution from: 21.94 to 25.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2344895.4 FinneganScanNumber: 1222
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 43.2    0.0053       -1.31   10   IPI00009865 K.YENEVALR.Q
 19.3       1.3       -4.70                    R.SSLAELMAR.T
 17.6       1.9       -1.32                    FETEQALR
 13.2       5.3        2.74                    K.SSNSSDLKR.H
 11.8       7.3      -12.64                    K.EYQVNGKR.V
 11.2       8.4        1024                    -.MAATLGSGER.W
 11.1       8.6        13.2                    -.MLMNELAR.N
 10.2        11        12.7                    R.YQNGAERR.W
  9.9        11        1017                    R.GSFSPRDAR.A
  9.9        11      -12.64                    R.SSANPSFKR.L
Top scoring peptide matches to query 788
Elution from: 21.92 to 25.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2344895.4 FinneganScanNumber: 1217
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 43.1    0.0055       -1.31   10   IPI00009865 K.YENEVALR.Q
 20.3         1       -4.70                    R.SSLAELMAR.T
 16.6       2.4       -4.72                    R.TMSEAALVR.K
 13.6       4.9        13.2                    -.MLMNELAR.N
 11.9       7.2      -12.64                    K.EYQVNGKR.V
 11.3       8.2        1028                    K.GDSSWTLAR.L
 10.7       9.4        1013                    R.EEQMRKR.E
 10.3        10         999                    K.IDLMVNSGK.L
 10.3        10        1002                    K.EEVEAFLR.S
 10.3        10        1002                    R.EYPESVIR.L
Top scoring peptide matches to query 789
Elution from: 21.96 to 25.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2344895.4 FinneganScanNumber: 1224
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 49.0    0.0014       -1.31   10   IPI00009865 K.YENEVALR.Q
 23.1      0.54      -12.64                    K.EYQVNGKR.V
 17.3       2.1       -4.70                    R.SSLAELMAR.T
 16.8       2.3        5.26                    R.KCSEKWR.S
 16.5       2.5      -12.67                    R.LGDPGPPAGGR.R
 14.7       3.8        2.74                    K.SSNSSDLKR.H
 13.5         5        12.7                    R.YQNGAERR.W
 13.4       5.1        1024                    -.MAATLGSGER.W
 11.1       8.6        1012                    K.GNEFWAIR.G
 11.1       8.6        1009                    R.KCTEWLR.G
Top scoring peptide matches to query 790
Elution from: 18.07 to 22.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 533830.5 FinneganScanNumber: 933
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.9      0.55        1001        R.IFETLQDK.Y
 22.6      0.59         998        R.MKITELDK.D
 20.8       0.9        1012        K.KNMVDRSK.L
 20.4      0.99        1019        K.RSSTGRDSK.S
 20.3         1        13.0        -.MMTAKAVDK.I
 19.6       1.2       -1.52        K.LGFGDLTSGK.S
 19.5       1.2        1023        R.KEMEAKNK.E
 19.2       1.3        16.4        R.GGFEPKMTK.R
 17.9       1.7        1012        -.MLSGNTKSR.E
 17.4         2        1001        R.QDVYDLLK.T
Top scoring peptide matches to query 791
Elution from: 17.99 to 22.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 533830.5 FinneganScanNumber: 927
Score greater than 29 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.9       1.4        1001        R.IFETLQDK.Y
 15.6         3         997        R.MAVMAMVIK.D
 14.8       3.6        1027        K.ASHPIPEDK.G
 14.7       3.7        1027        K.ENLFQTNK.L
 14.5       3.8        1012        K.KNMVDRSK.L
 12.6       5.9        1019        K.RSSTGRDSK.S
 11.2       8.3        1023        K.TNQMAATIK.Q
 10.6       9.5        1012        K.EKQMSSRK.D
 10.5       9.6        13.0        -.MMTAKAVDK.I
 10.3        10       -4.87        R.KKMSLEDK.E
Top scoring peptide matches to query 792
Elution from: 22.18 to 26.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 345364.8 FinneganScanNumber: 1245
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 793
Elution from: 35.27 to 39.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1913223.7 FinneganScanNumber: 2471
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        17        7.56        K.HVIEELTR.E
  6.4        17        1015        -.MGRVFITR.T
  6.2        18        14.8        K.IFFAEEIK.K
  6.2        18        0.14        K.ISKFMKDK.E
  5.8        20      -19.05        K.WHASKVLR.I
  5.5        21       -3.72        R.YSVKTSRR.V
  3.5        33        1026        R.MFLNKTNK.E
  3.5        33       -7.77        K.FLQSFARK.S
  3.5        33        0.14        -.MLKSIFNK.L
  0.9        61        1015        RYVAAMIR
Top scoring peptide matches to query 794
Elution from: 35.18 to 39.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1913223.7 FinneganScanNumber: 2455
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.4       8.6         997        R.VLATQPGPGR.G
  6.8        16        1022        R.QVGHVGSGVR.D
  2.8        39        17.5        R.NKPHTPFR.A
  2.6        41         997        K.NLLIEHTR.K
  2.5        42         993        K.QYLAVVFR.D
  2.4        43        0.14        K.IHEPIMLK.Y
  2.3        44        0.14        K.ISKFMKDK.E
  2.3        44        0.12        R.TNIKFMVK.L
  2.3        44        18.8        R.LQAYTSVSK.A
  2.3        44        1001        -.MFKLIDTK.I
Top scoring peptide matches to query 795
Elution from: 30.67 to 34.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2226803.3 FinneganScanNumber: 2013
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.9       3.4        1016        R.GGTLGPVPLGK.Q
  5.3       9.9        1005        K.RPAVAPLSGK.E
  2.1        21        1008        R.RGRPPTRR.R
  2.0        21        4.17        M.LVKPQQQR.E
  1.9        22         994        R.RKGVPSVPR.N
  1.3        25       -7.09        -.XAPVRLRR.C
Top scoring peptide matches to query 796
Elution from: 30.61 to 34.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2226803.3 FinneganScanNumber: 2005
Score greater than 17 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.3        10       -7.11        R.HVRSTLRK.G
  4.1        13        15.5        K.DPSIPRLAK.E
  2.2        20        1008        R.RGRPPTRR.R
  2.1        21        4.17        M.LVKPQQQR.E
  1.2        25      -13.85        K.ITFYILVK.A
  1.2        25        11.4        R.KSLNLFFK.K
  1.2        25        0.14        R.KSRFALFK.R
Top scoring peptide matches to query 797
Elution from: 30.61 to 34.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2226803.3 FinneganScanNumber: 2004
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8       4.5        1016        R.AVILGPPGSGK.G
  8.7       4.5        1005        K.RPAVAPLSGK.E
  8.2       5.1        1016        R.GGTLGPVPLGK.Q
  5.7       9.1        1005        K.APKPGGLSLR.A
  5.6       9.3        1016        R.ELEKVLHK.F
  4.0        13        1027        R.TTTALTIFK.A
  2.8        18        4.17        M.LVKPQQQR.E
  2.8        18        1008        R.RGRPPTRR.R
  2.6        19        4.19        K.IKEHVRSK.T
  2.5        19        0.14        R.KSRFALFK.R
Top scoring peptide matches to query 798
Elution from: 20.22 to 24.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 763017.4 FinneganScanNumber: 1069
Score greater than 22 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.2       2.1        1.26        K.QHQVCGDR.R
  8.9       3.7        19.6        -.MAMAMAMAR.S
  6.8         6        19.6        -.MAMAMAMAR.S
  6.6       6.2        1018        K.EAMSEMLR.H
  6.3       6.7        19.1        -.MATCHSHR.T
  6.1       7.1         993        K.SNDGFTTTR.S
  5.9       7.4       -5.27        R.GADPDASPGGR.G
  5.6       7.9       -5.24        K.LEDSENHR.N
  4.9       9.2         993        R.GQYSAETSR.L
  4.5        10      -12.65        K.EPPSPGMER.K
Top scoring peptide matches to query 799
Elution from: 37.13 to 41.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2627184.2 FinneganScanNumber: 2787
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.7         6        8.55        R.GGAGKIWRR.S
  8.1        17        9.90        K.TLEQLIQR.G
  7.4        20        5.88        WPIKESLK
  6.1        28        1021        M.PSEVARGKR.A
  5.8        30        16.4        K.XMKTALKR.K
  2.5        63        1018        R.ETALLIDPK.N
  1.8        73        1016        R.GIHSLGLFR.L
  1.6        76        19.8        K.HFPSTKRK.R
  1.6        77       -1.34        M.LTPTERKR.Q
  1.4        81        9.90        R.LTSRGLPEK.A
Top scoring peptide matches to query 800
Elution from: 37.09 to 41.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2627184.2 FinneganScanNumber: 2777
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       6.8        1021        R.IEAGIRGAGR.G
  9.2        14        9.90        K.LTLSSNPLR.S
  7.2        21         995        R.DIKGANILR.D
  5.9        28        12.6        R.TGARGVRGAR.Q
  5.5        32         995        R.GVVTVLAGQR.G
  5.1        34        12.6        K.GRRAVSAGAR.G
  1.9        72      -15.27        K.DDVIVALKK.A
  1.2        84       -1.34        K.QSLRELVR.T
  0.5        99        1016        K.WKGTGVPVR.S
  0.5     1e+02         995        R.KKDTLAPAR.Q
Top scoring peptide matches to query 801
Elution from: 34.72 to 38.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 127839904.1 FinneganScanNumber: 2398
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       9.2        1020        R.SGPPSKSGKR.G
  8.5        19         995        R.IEKRPLSTG.-
  7.5        24        1008        R.DEGRVLRR.L
  6.6        29        1024        R.SPPQLMISK.V
  6.6        29        1024        R.SPPQLMLSK.V
  5.5        38        1020        R.AAVAEDLRR.R
  3.9        54        1008        K.AREAELRR.L
  3.2        64        1016        R.NVLEALWR.I
  1.2     1e+02        1004        K.SPPPPPPRR.S
  0.3   1.2e+02        1020        R.AVGDVLRDR.F
Top scoring peptide matches to query 802
Elution from: 37.81 to 41.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 79212163.2 FinneganScanNumber: 2902
Score greater than 13 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.4        59         995        R.IEKRPLSTG.-
  0.7   1.1e+02      -12.29        R.NKSQKQLR.E
  0.7   1.1e+02      -14.99        R.LIGVTEIEK.G
Top scoring peptide matches to query 803
Elution from: 34.72 to 38.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 127839904.1 FinneganScanNumber: 2401
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.3       7.4         995        R.IEKRPLSTG.-
  9.0        16         993        R.GGAGKIWRR.S
  5.8        33        1020        R.LQEANKAAR.K
  5.5        36        1005        K.LAWELGRR.H
  5.1        39        1009        R.IRRGDDLR.L
  5.1        39        1009        R.LRRGDDLR.L
  4.8        42        1005        K.SPPPPPPRR.S
  4.0        50        1020        R.SGPPSKSGKR.G
  3.7        54        12.8        R.SQRRTTPR.W
  3.5        56        1024        R.SPPQLMISK.V
Top scoring peptide matches to query 804
Elution from: 37.36 to 41.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 125903342.3 FinneganScanNumber: 2825
Score greater than 26 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.1       3.1      -12.24        R.SLAITQGRR.A
 12.8       6.6       -1.02        K.ATDKVSKPR.E
 12.7       6.8       -2.35        R.RAIGSWRR.T
 12.4       7.2        1020        M.ANNDAVLKR.L
 11.7       8.6        9.35        -.MKLITHMK.T
 11.1       9.9       -8.40        K.KMPGAGSILK.W
 10.5        11        1001        K.XMKTALKR.K
 10.2        12        1020        K.ELQLREGR.L
  9.7        14        1020        M.ELRSTAAPR.A
  9.6        14         995        R.VQEEVKLR.Q
Top scoring peptide matches to query 805
Elution from: 34.88 to 38.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 127839904.1 FinneganScanNumber: 2421
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.8       8.7        1016        R.DPAKAFVPR.T
  8.1        20        1020        R.SGPPSKSGKR.G
  4.9        42      -14.60        R.LIGVTEIEK.G
  4.7        44         994        R.GGAGKIWRR.S
  4.2        50        17.1        R.RSCLLAPGK.G
  4.0        52         995        R.IEKRPLSTG.-
  3.7        56        1020        R.SSSSLRVHK.R
  3.4        61        9.19        -.XAGGAFRGLR.A
  3.0        65      -14.57        R.LKELEELK.A
  3.0        66       -4.73        K.GVTPAGFPKK.A
Top scoring peptide matches to query 806
Elution from: 35.07 to 39.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 127839904.1 FinneganScanNumber: 2441
Score greater than 15 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3        26        1002        -.MSLRLQPR.Y
  2.4        81        1002        -.MARLPAGIR.F
  1.7        93         984        K.QEISRLVR.E
  1.7        93        1009        R.QGGLAGSVRR.I
  1.6        97        1020        K.LKENNLNR.L
  1.4     1e+02         984        K.AGVKATLNAR.T
  1.3     1e+02        1020        K.ELQLREGR.L
  1.1   1.1e+02        1013        R.KLKPMDPR.R
  0.8   1.2e+02        1005        K.ELQIWRR.W
  0.8   1.2e+02        1020        M.EQEARVLR.A
Top scoring peptide matches to query 807
Elution from: 37.39 to 41.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8063664.0 FinneganScanNumber: 2831
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.6       6.7        5.95        K.VPLSPLPGPK.Q
  6.6       8.4        1013        K.WSVLKSRK.L
  3.3        18        1020        R.KLKDIMQK.E
  2.8        20        1020        R.KNKILEMK.T
  2.1        24        1001        R.AAARFLARK.L
Top scoring peptide matches to query 808
Elution from: 37.36 to 41.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8063664.0 FinneganScanNumber: 2825
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3       7.1        1013        K.LGFPKKASR.T
  7.0       7.6        16.5        K.LLKMTSRR.L
  5.7        10        1001        R.RAAFAARLK.A
  3.6        17        1020        R.IVVEMIKR.E
  3.1        19        1003        K.IKKVGTTEK.E
  1.9        25        9.97        R.VSKTSLKNK.F
  1.8        25       -5.21        K.KIFEALKR.G
  1.7        26       -5.23        K.LPLPPAIQR.Y
  1.7        26        2.60        R.LMKITGLTK.G
Top scoring peptide matches to query 809
Elution from: 34.72 to 38.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 13673168.3 FinneganScanNumber: 2400
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1        12        19.8        R.FNVAVTRAK.A
  5.3        15         983        R.VLLVMSKAK.R
  2.4        30        1012        R.YGKPILASR.D
  2.0        32        1000        M.SFVAGVIRR.L
  1.8        33         989        R.RQYLRLR.G
  1.8        33         989        R.RYAVARLR.Q
  1.8        33        1000        K.VSLFNRLR.S
  1.7        35         997        R.LAMLKTRR.S
  1.6        35         989        R.FRVRAISR.V
  1.6        35        1000        K.GVGAIYIRR.R
Top scoring peptide matches to query 810
Elution from: 23.67 to 27.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 717990.4 FinneganScanNumber: 1372
Score greater than 16 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 811
Elution from: 23.65 to 27.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 717990.4 FinneganScanNumber: 1369
Score greater than 16 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 812
Elution from: 35.67 to 39.67 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 917495.3 FinneganScanNumber: 2536
Score greater than 19 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.2       2.1       -2.31        R.MHAGCXYR.R
  6.1       2.8         976        K.CGRGGMSGGR.S
  3.7       4.8      -19.89        K.FGNGESGMGR.I
  3.2       5.4         999        -.MASDCGPTR.K
  2.5       6.4         981        K.EMGSQEGTR.L
  1.5         8       -8.76        R.ETEYGPCR.R
  0.3        10      -12.10        K.MNSQVCEK.V
Top scoring peptide matches to query 813
Elution from: 37.81 to 41.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 501507.6 FinneganScanNumber: 2897
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4        17         991        K.KRQFEMR.R
  6.2        22        1006        K.KRMAMAMR.Q
  4.9        30        1006        R.LGEGGGFAFR.W
  4.5        32        1010        -.MMTAKAVDK.I
  2.6        50        1010        K.KFDSSRDR.N
  1.2        68      -12.10        R.NPLPDGRSR.W
  1.2        69         991        K.RQFEMKR.K
  0.9        74        1010        R.LMMEQSKK.S
  0.8        76         978        K.LLDFCKSK.D
  0.5        81        1010        R.LMMEQSKK.S
Top scoring peptide matches to query 814
Elution from: 24.11 to 28.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 287955.4 FinneganScanNumber: 1413
Score greater than 22 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.2         2       -1.38        K.RTLIRPAGK.A
  8.4         3      -15.16        M.SVLTPLLLR.G
  8.3       3.1         984        K.RTPALIALR.Y
  7.9       3.4        9.75        K.KLEQLKPR.A
  7.7       3.5        9.72        R.GVTIQPLKR.D
  6.8       4.3        1009        K.RGQRLVGPK.G
  6.5       4.7        9.75        K.KGAAIPAKGAK.N
  6.0       5.2        9.73        R.KLLAVQPSR.G
  5.9       5.3      -12.49        R.RGRLAVLAR.L
  4.3       7.7        9.73        K.VKKAPGVANK.K
Top scoring peptide matches to query 815
Elution from: 26.73 to 30.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2779049.2 FinneganScanNumber: 1684
Score greater than 29 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.1       1.3        15.5        K.IKNGTPPMR.K
 15.1       2.1       -6.03        K.IIDFGLAHK.I
 15.1       2.1       -6.03        K.LIDFGIAHK.I
 13.7       2.9        7.72        R.LQFHQKGR.S
 12.1       4.2       -2.03        K.LGALELNQR.D
  8.8       9.1       -9.34        R.ELLLLCPR.I
  8.6       9.5      -17.10        K.KIIPWNSR.V
  8.6       9.5       -2.05        R.QILQADGLR.G
  8.6       9.5         993        R.SPGLPVSDLK.T
  8.4        10         996        R.SPLGARAGGAR.V
Top scoring peptide matches to query 816
Elution from: 26.71 to 30.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2779049.2 FinneganScanNumber: 1682
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.1       2.7       -2.06        K.NLVDAGGVLR.W
 13.6         3      -17.10        K.KIIPWNSR.V
 12.6       3.8       -2.05        R.QILQADGLR.G
 12.5       3.9      -13.12        R.QLEAQIRR.L
 11.7       4.7         984        M.RAGRGATPAR.E
  9.3         8        7.72        R.LQFHQKGR.S
  9.1       8.5       -2.06        R.TTIGAAGLPGR.D
  8.6       9.6         996        R.VALSHSSRR.Q
  7.9        11         982        R.LLGASGNPVGK.G
  6.9        14       -2.05        R.LEAGAAVVAGR.V
Top scoring peptide matches to query 817
Elution from: 26.91 to 30.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2779049.2 FinneganScanNumber: 1702
Score greater than 28 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.7       1.2         993        R.SPGLPVSDLK.T
 14.3       2.5      -17.10        K.KIIPWNSR.V
 10.8       5.7       -2.03        K.NNILNLQGK.G
  8.9       8.9       -2.03        K.LGALELNQR.D
  8.8       9.2        18.8        R.AWPEVGRAK.I
  7.3        13        1007        R.QLNLGQPSR.S
  6.6        15       -6.03        K.IIDFGLAHK.I
  6.6        15       -6.03        K.LIDFGIAHK.I
  6.4        16        4.42        K.MARPRASPK.Y
  5.1        21         982        K.SPGVPAGAKTK.K
Top scoring peptide matches to query 818
Elution from: 21.36 to 25.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 207124.1 FinneganScanNumber: 1166
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       6.4      -12.18        R.ARAQAEIKK.K
 10.4       8.4       -1.13        M.GSPGASLGIKK.A
 10.2       8.8      -12.20        K.LLGNKRDAK.S
 10.2       8.8      -12.20        R.IPSASQRKK.A
  9.5        10        12.6        R.AVGNKNRQK.F
  8.5        13        9.95        K.GLLDGIELGK.S
  8.1        14         992        K.NGIHVFAKK.V
  7.4        17      -12.24        K.IGVVGRTGAGK.S
  7.3        17       -1.11        R.KLQQELQK.I
  7.3        17       -1.11        R.LQQQLEKK.Q
Top scoring peptide matches to query 819
Elution from: 34.88 to 38.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 32934874.7 FinneganScanNumber: 2419
Score greater than 26 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.5       2.9        5.37        K.GFKELPSIK.C
 12.9       4.3        2.04        R.VLGMTLIQK.C
 11.9       5.4         970        -.MGKIALQLK.A
  9.9       8.5         970        K.KVMAPSKIK.V
  9.6       9.1         977        K.TIKTIQASR.L
  9.6       9.1         988        R.IDLSKKEGK.V
  8.8        11        11.8        K.MKAIGWGKK.T
  7.9        13      -16.71        -.XKERGLFR.G
  7.9        13      -16.71        -.XKERGLFR.G
  6.8        17         988        K.SKVQDLSLK.A
Top scoring peptide matches to query 820
Elution from: 34.85 to 38.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 32934874.7 FinneganScanNumber: 2414
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.9       2.7         998        K.FSAKGLAPAR.G
 10.6       7.2        1002        K.LTGAVRSSAR.L
  9.9       8.5         977        K.TIKTIQASR.L
  7.5        15        15.8        K.ADMLKRLR.R
  6.8        18        15.8        -.MNGKKVLGR.I
  6.4        19        8.54        K.LLKMAVGMR.A
  5.7        23         988        -.MILLLQMR.K
  5.2        25        8.06        K.RKGPPGPPGR.G
  3.8        35        15.8        R.RLGKMGAAAK.L
  3.7        36         984        R.EFIAPVTLK.V
Top scoring peptide matches to query 821
Elution from: 35.12 to 39.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 32934874.7 FinneganScanNumber: 2447
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.3         2         988        R.SVSQDLIKK.E
 14.4         3         988        K.EKDIKGLSK.K
 10.2         8         977        K.SNSLISIKR.L
  9.6       9.2      -16.63        K.VLHVQLGPR.W
  9.1        10        1006        -.XAVAIEKVK.L
  8.9        11         988        R.EKPLSTKSK.K
  8.6        12       -8.87        R.MLRKAALSL.-
  8.3        12        9.41        K.VTGGAASKLSK.I
  8.0        13         988        R.ISTSILDLR.D
  7.4        15        9.43        R.SLESVLSRK.L
Top scoring peptide matches to query 822
Elution from: 35.67 to 39.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 32934874.7 FinneganScanNumber: 2534
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.5       1.9       -5.36        R.TPLPLAGPPR.R
  5.5        24        19.4        R.HNSALVIHK.A
  5.5        24         995        K.CLVKIQTR.R
  5.5        24         978        K.RDKTLTGVK.Y
  4.9        27       -5.34        R.ELFKKTPR.Q
  4.9        27        1006        K.MDLVGNIKK.V
  3.0        42         995        R.KILMNVQR.E
  3.0        42       -8.66        R.ILMGSTLRK.R
  2.7        45        9.62        K.LSTTDRVVK.A
  2.7        45       -8.66        K.GSMKPVKKK.K
Top scoring peptide matches to query 823
Elution from: 22.45 to 26.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1526333.7 FinneganScanNumber: 1269
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 47.6    0.0019       -0.86    1   IPI00301263 R.ELSDLESAR.Q
 35.3     0.034        8.84   24   IPI00790962 R.DAGLSWGSAR.D
 20.0       1.1         991                    R.DGREVEGTR.T
 18.5       1.6         987                    K.QEWLEASR.G
 17.8       1.9        10.1                    R.DVDLDLSDK.D
 16.1       2.8        12.7                    -.XGGGGGGGGSSLR.M
 15.9       2.9        19.2                    K.NQSMRGNGR.K
 14.4       4.1      -11.90                    K.ADGLSKDASR.C
 12.7       6.1        5.53                    K.DDVDMLRR.E
 12.3       6.6        5.54                    K.SQLNELCR.F
Top scoring peptide matches to query 824
Elution from: 22.38 to 26.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1526333.7 FinneganScanNumber: 1261
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 30.5       0.1       -0.86    1   IPI00301263 R.ELSDLESAR.Q
 12.4       6.5        12.6                    K.YVSYGVMGK.I
  9.7        12      -11.88                    R.KEEKGDSAR.K
  9.1        14         966                    R.GKEDISQNK.D
  9.0        14      -19.79                    R.LESPYPWK.W
  8.8        15        1002                    R.EQDEKQNK.D
  8.8        15         991                    R.DGRDGAKGDK.G
  8.7        15        8.84   24   IPI00790962 R.DAGLSWGSAR.D
  8.6        16         966                    R.KAEGDAKGDK.A
  8.6        16      -11.90                    K.ADGLSKDASR.C
Top scoring peptide matches to query 825
Elution from: 21.51 to 25.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2136585.8 FinneganScanNumber: 1178
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 54.7   0.00042       -1.20    1   IPI00301263 K.SVGEVMGIGR.S
 19.6       1.4         982                    -.MVAVCGGLGR.K
 16.4       2.8        2.12                    K.GESPLGSFAR.R
 16.1         3        19.5                    M.WLVECTGR.D
 15.6       3.5      -18.62                    R.SVVSSVEGTR.E
 14.5       4.5        8.51                    K.QFCKGAPGR.F
 12.5         7         979                    R.SPGGGYEPKK.D
 12.4       7.2       -4.96                    K.RSSVSSGGAGR.L
 10.9        10       -1.19                    R.TLLAQGMDR.L
 10.7        11        4.57                    K.TMLAWGWR.I
Top scoring peptide matches to query 826
Elution from: 21.36 to 25.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2136585.8 FinneganScanNumber: 1164
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 47.9     0.002       -1.20    1   IPI00301263 K.SVGEVMGIGR.S
 17.3       2.3         982                    -.MVAVCGGLGR.K
 14.8       4.1         994                    K.ADGQVVSSEK.K
 13.0       6.3         994                    R.VSNAESSTPK.E
 12.3       7.3         990                    R.SQRPMGTSR.R
 11.2       9.6        1.43                    R.GTRGGMGRGR.L
 11.0       9.9      -19.90                    R.SRERGPYR.T
 10.7        11      -18.62                    R.SVVSSVEGTR.E
 10.5        11         983                    R.SVVANDASTR.A
  9.9        13         979                    R.WTLDLESR.Y
Top scoring peptide matches to query 827
Elution from: 21.36 to 25.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 767311.0 FinneganScanNumber: 1167
Score greater than 32 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 51.8   0.00088         982    1   IPI00301263 K.SVGEVMGIGR.S
 16.1       3.3         964                    R.SVVSSVEGTR.E
 14.6       4.6         999                    R.QRSGWSSGR.S
 13.9       5.3        1003                    M.WLVECTGR.D
 13.9       5.4         978                    K.RSSVSSGGAGR.L
 12.2         8        19.9                    R.NIGSNYPEK.L
 11.4       9.6         984                    R.GTRGGMGRGR.L
 10.7        11         993                    K.SVTDSVMGPK.Y
 10.6        11         993                    K.EEITMEIR.K
 10.2        13        8.86                    K.EGPGPGPGTPR.R
Top scoring peptide matches to query 828
Elution from: 37.47 to 41.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1934335.3 FinneganScanNumber: 2843
Score greater than 16 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.4       1.5        5.77        K.TLTVLHPLK.V
  3.2       5.1        8.42        R.LRGPRPVAR.G
  2.7       5.7        8.42        R.RPLRPGAVR.K
  2.6       5.8        19.4        R.AARALPPGLR.A
  2.6       5.8         971        R.LLKYKVTR.G
  2.6       5.8        5.78        R.TSVLFKKAK.N
  2.1       6.6         982        K.LLYKASVVK.K
  1.9       6.9         999        R.FQLLMKLK.S
  1.5       7.5        5.78        K.VAELVHILK.H
  1.4       7.7        19.4        K.HLKAQGLVR.K
Top scoring peptide matches to query 829
Elution from: 26.23 to 30.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 526121.0 FinneganScanNumber: 1632
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.7       5.7         976        R.AEHDPLKGR.L
 11.4       7.8        19.1        R.SFLRCQGR.G
 11.2       8.1        12.7        K.DPEQPPKGR.V
 11.1       8.3       -9.20        R.QHANERLR.R
 10.2        10        8.14        R.RGRGGSMFR.L
  8.6        15      -11.84        KFSDAIQSK
  8.0        17        9.47        K.KTMEGRSSK.V
  7.1        21         998        -.XNFEGEVTK.E
  6.6        23        5.51        K.TLSLMTWR.S
  6.5        24        8.17        K.RRMQYNR.R
Top scoring peptide matches to query 830
Elution from: 35.23 to 39.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3825362.6 FinneganScanNumber: 2464
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.8       3.5         994        R.GPPPQSVAGGR.R
 11.4       7.7         977        K.IEGISKMTK.L
  9.9        11         979        K.NHWSLLPR.E
  6.9        21        1002        K.LMQNSGKTK.F
  6.4        24         983        -.XEAHRASPR.E
  6.3        25         995        K.IKAMGIMDK.L
  6.2        25         987        M.VACYALLGR.T
  5.5        30         969        K.NTGVYLISR.L
  5.3        31         969        R.SQYRDLLK.A
  5.1        33         969        R.DLYEKAKR.D
Top scoring peptide matches to query 831
Elution from: 35.63 to 39.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2982145.7 FinneganScanNumber: 2527
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.3        12         995        R.GPPPQSVAGGR.R
  8.6        14      -14.93        R.GATKGTHPVR.L
  7.2        19         984        K.TKKMMDLR.T
  7.0        20      -11.13        R.EAFLKMLR.F
  5.6        27         991        R.GEALPPWPR.L
  5.4        28        17.4        R.SVRMGKSSR.S
  5.4        28       -3.91        R.TXKQIYASR.V
  5.2        30      -11.13        LQALYMIR
  4.7        33         984        R.RQETHPVR.R
  4.6        34         999        R.SSRSTRSNK.S
Top scoring peptide matches to query 832
Elution from: 35.77 to 39.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2982145.7 FinneganScanNumber: 2553
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.5        11         999        R.SSRSTRSNK.S
  6.0        25      -14.93        R.GATKGTHPVR.L
  5.9        25         995        R.GPPPQSVAGGR.R
  5.4        28       -7.20        K.KLSSSSKMR.V
  4.2        38       -3.93        R.TKGYDGVKR.W
  3.3        46         995        R.GPAAPPGDKGR.L
  3.1        49         992        -.MSLRGSLSR.L
  2.4        57         974        R.VPLMTVLSF.-
  2.0        63        9.71        R.HLNAERQR.L
  1.8        66        17.4        R.SVRMGKSSR.S
Top scoring peptide matches to query 833
Elution from: 26.27 to 30.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 286381.6 FinneganScanNumber: 1638
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.4       1.4        7.18        K.LATDDFKSK.Y
 14.4       3.4         966        K.KESKVSMSK.N
 12.8       4.9      -11.01        K.LLEFCKSK.D
 10.7         8        7.21        K.QELEYKSK.L
 10.5       8.5        13.5        -.MSSVFGKPR.A
  9.7        10       -7.09        -.MGQTKTKSK.Y
  8.2        14      -11.02        M.DVFMKGLSK.A
  8.2        14         984        K.GTTTTTNISK.A
  8.0        15        3.90        K.KLSVMESSK.S
  7.3        18      -14.75        K.QHAALAAQSK.S
Top scoring peptide matches to query 834
Elution from: 28.07 to 32.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7315266.7 FinneganScanNumber: 1802
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.2        17        1000        K.CLSPEYAGK.A
  6.5        20      -18.89        R.AGFMSKTQR.G
  6.4        21       -4.65        K.SFADPSVFR.K
  5.7        24      -11.20        R.MKSXMLQK.K
  5.4        26       -0.71        M.GSPEPTQGPR.L
  5.4        26         975        -.MCVSTRVR.A
  5.4        26         989        M.DQYCILGR.I
  5.3        27        16.6        R.APHTPCSQK.K
  5.0        28       -0.71        R.DPTGPAAGPSR.V
  4.5        32        13.4        -.MSMLAERR.R
Top scoring peptide matches to query 835
Elution from: 26.50 to 30.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 406029.1 FinneganScanNumber: 1657
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 41.5    0.0034       -0.97   17   IPI00014424 K.IGGIGTVPVGR.V
 19.7      0.51        19.7                    K.YALPLVGHR.K
 17.8       0.8        12.7                    R.RLAAADPRR.G
 12.8       2.5        12.7                    R.LRGAAERPR.R
 12.8       2.6        12.6                    R.GPGERVRVR.G
 12.4       2.8        12.6                    R.LGRAGGKPGGR.G
 11.4       3.5      -11.88                    K.TALLQARPR.L
 10.3       4.4         974                    K.RGGRGIVPGR.L
 10.3       4.5         985                    R.GPQGALGRLR.E
  9.6       5.3      -11.91                    R.GALVRGTPVR.G
Top scoring peptide matches to query 836
Elution from: 30.42 to 34.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1563208.4 FinneganScanNumber: 1988
Score greater than 26 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 20.4      0.24         994    9   IPI00029446 R.RVPRPFPR.L
 12.4       1.5        12.3                    R.RVPQKELR.G
 10.0       2.7        1.35                    M.RVQTRPLR.S
  9.9       2.7         970                    R.VRPHLFKK.K
  9.5         3       -2.57                    R.RAWKVIPR.K
  9.5         3        12.3                    K.TALLQARPR.L
  8.5       3.8         998                    R.VRAAAGARPR.L
  8.5       3.8         974                    R.KAQVRGLPR.A
  8.5       3.8         985                    R.LLAARDLPR.A
  8.5       3.8         985                    -.LLGERAIPR.A
Top scoring peptide matches to query 837
Elution from: 30.37 to 34.39 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1563208.4 FinneganScanNumber: 1982
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 15.0      0.84        1.35                    M.RVQTRPLR.S
 14.5      0.94         974                    R.KAQVRGLPR.A
 14.5      0.95         994    9   IPI00029446 R.RVPRPFPR.L
 13.4       1.2         985                    K.QAALKQLPR.N
 13.2       1.3        12.3                    R.RVPQKELR.G
 10.4       2.4       -1.27                    R.IVILPSLDR.S
  9.8       2.8        11.0                    R.VRPWRRR.C
  9.7       2.9         985                    -.LLGERAIPR.A
  9.6       2.9         996                    R.AEAALLLAPR.S
  9.5         3        12.3                    K.KQQQKPXR.K
Top scoring peptide matches to query 838
Elution from: 30.29 to 34.30 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1563208.4 FinneganScanNumber: 1974
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 17.2      0.51         996                    K.NAVTPLKPGK.H
 15.4      0.78         985                    K.QAALKQLPR.N
 14.8      0.88        16.1                    -.MPLLGLLPR.R
 13.4       1.2         985                    K.IQRLLEPR.Q
 13.2       1.3         985                    R.LLAARDLPR.A
 13.2       1.3         985                    -.LLGERAIPR.A
 12.8       1.4        12.3                    R.RVPQKELR.G
  9.3       3.2         996                    R.LLLADNPLR.C
  8.5       3.8         994    9   IPI00029446 R.RVPRPFPR.L
  7.0       5.4        1.37                    R.RSLPAVARR.F
Top scoring peptide matches to query 839
Elution from: 36.79 to 40.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3326994.2 FinneganScanNumber: 2727
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.7       6.2         981        K.ALKSVIDSPP.-
  8.2        11         970        R.TLGQLLPER.Y
  7.3        13         994        K.SPTIPRAER.G
  6.1        18         972        R.GRGGRSLPAR.C
  5.5        20         959        R.LAQAVGAGALR.A
  4.7        24      -11.74        R.ALSPGGRTLR.S
  4.6        25      -11.74        R.SAAPVARVTR.T
  4.4        26      -11.74        K.SKGPKLGQGR.W
  3.9        29        5.58        K.KMAHQLKR.K
  3.6        31      -11.72        R.LQAAGNAVKR.A
Top scoring peptide matches to query 840
Elution from: 37.33 to 41.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1804457.5 FinneganScanNumber: 2819
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.2       9.1         977        R.LKEAPNISR.E
  9.8       9.9         966        R.GRLAPLASSR.F
  7.0        19        18.0        R.IQSLPDLSR.L
  6.6        21       -0.11        R.VLDMPGIKR.I
  5.9        24        18.0        K.EIEPVASKR.K
  5.7        26        18.0        R.DNIVEGIIR.S
  5.1        29         958        K.LPCKILQR.I
  4.8        32         988        K.DPLLVEVSR.L
  3.5        43         966        R.SSTLAKHKR.I
  3.3        44         977        K.KSSISQIHK.I
Top scoring peptide matches to query 841
Elution from: 37.23 to 41.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4390182.1 FinneganScanNumber: 2804
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.1        18        20.0        R.AAAPAFPAASR.R
  4.5        41         957        K.AVLDELGRR.T
  2.7        63         992        R.DRGPALAGSGK.G
  0.1   1.1e+02         992        K.SSTLISHQR.M
Top scoring peptide matches to query 842
Elution from: 37.19 to 41.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4390182.1 FinneganScanNumber: 2797
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.1        18        2.05        R.RSRAGAGGAAR.A
  7.2        22         992        R.DRGPALAGSGK.G
  7.2        22        16.7        K.MGSQLPKPR.M
  6.1        28        9.05        R.RADKPWTR.L
  6.0        29      -11.48        R.DARGALSALR.E
  5.5        33        13.0        R.NNVVRGASGR.L
  5.4        34        16.7        K.NIMSKVHGK.R
  5.4        34        20.0        K.ITWTQAPGR.V
  5.3        34         989        R.YSPSPPPKR.R
  5.3        35        10.4        R.VESLSPELR.G
Top scoring peptide matches to query 843
Elution from: 16.20 to 20.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 381769.7 FinneganScanNumber: 819
Score greater than 32 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 23.6      0.51      -12.22        K.LGLTLNKDR.R
 18.4       1.7         981        K.AVLDELGRR.T
 15.3       3.4         966        R.VSPRGFLPR.R
 14.5       4.1         981        R.QGAKINEIR.Q
 14.0       4.6      -16.15        R.IGTLFHLTK.H
 12.3       6.8         992        K.EIQVGDVIR.L
 11.9       7.4         992        K.QLSTLTTHK.I
 11.8       7.7      -12.23        K.VAAVSTIVNR.G
 11.5       8.2        16.0        VMSIPDVIR
 11.2       8.8         992        K.VALLEDVNR.M
Top scoring peptide matches to query 844
Elution from: 24.13 to 28.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 11726195.9 FinneganScanNumber: 1415
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 845
Elution from: 31.59 to 35.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1200669.8 FinneganScanNumber: 2098
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 76.5     3e-06       -1.23    1   IPI00301263 R.SILEQLAEK.N
 31.4     0.096         955                    R.AELEAALGKK.H
 28.2       0.2       -1.21                    R.LAKELEEAK.A
 28.1      0.21         980                    K.AQINKQAEK.K
 27.9      0.22      -12.15                    R.LSLERDGLK.S
 24.0      0.53      -12.18                    R.VTLIVDNTR.F
 23.4      0.61        12.3                    K.AELEKERR.E
 21.9      0.87        1.38                    R.ISQNERRK.M
 21.1         1       -1.23                    K.SLEIAIEQK.K
 20.9       1.1      -12.15                    K.LSKLQGEQK.K
Top scoring peptide matches to query 846
Elution from: 31.58 to 35.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2017559.7 FinneganScanNumber: 2096
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 39.8     0.013         986    1   IPI00301263 R.SILEQLAEK.N
 23.2       0.6         975                    K.EALISQLTR.G
 16.3       2.9        1.08                    R.NMTKLQLAL.-
 16.3       2.9         986                    K.EELAEALKK.L
 15.9       3.2         975                    R.VTLIVDNTR.F
 15.1       3.8         975                    R.LSLERDGLK.S
 14.4       4.5         978                    R.AQARARTTR.D
 13.6       5.5        1.07                    R.MVGNLLSLGK.R
 13.2       5.9         975                    K.LSLDELGRK.Y
 13.1       6.1        19.2                    R.AKDKLEEAK.K
Top scoring peptide matches to query 847
Elution from: 25.98 to 29.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 21605149.1 FinneganScanNumber: 1613
Score greater than 30 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.0       1.4       -0.41        R.SRSASAIALR.T
 16.8       2.3        10.5        R.GTIKTEINR.K
 16.4       2.5         984        K.MRAAELALR.S
 14.3       4.2        16.8        -.MAAGIVASRR.L
 13.7       4.7       -0.42        R.RNSSLLSVR.L
 13.1       5.4        16.8        K.SRGVVMLNR.V
 13.1       5.4        16.8        -.MLSKGRSPR.R
 12.4       6.3         955        R.RNGSSIKIR.L
 12.1       6.9         977        K.KTESSLLPR.C
 11.4         8         994        R.KASMLEVPR.A
Top scoring peptide matches to query 848
Elution from: 37.78 to 41.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6491038.3 FinneganScanNumber: 2894
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8       6.9         986        K.QTLPPPLHK.A
  9.8       6.9         986        R.VKPDPPHIK.N
  8.8       8.8         955        K.IQAKSKSLR.G
  4.9        22         976        R.LGLSTLGELK.Q
  4.9        22      -15.85        R.VPLSHLPLR.T
Top scoring peptide matches to query 849
Elution from: 37.51 to 41.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6491038.3 FinneganScanNumber: 2851
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8        11      -15.85        R.VPLSHLPLR.T
  6.8        14         990        R.KRSLEELR.A
  4.7        23         979        R.RNGSSIKIR.L
  4.2        25         983        -.MVKVLDAVR.G
Top scoring peptide matches to query 850
Elution from: 37.61 to 41.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6491038.3 FinneganScanNumber: 2865
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.0       6.6         955        K.IQAKSKSLR.G
  7.1        13         955        K.KLQAKVTSR.K
  6.8        14         990        K.KAKLQDTAR.V
  5.8        17         972        K.LTLRCLVR.M
  5.8        18         979        R.RNGSSIKIR.L
  5.6        18        5.30        K.MRKLSQLR.A
  2.7        35      -15.85        R.VPLSHLPLR.T
  1.8        44         976        K.LTLSALIDGK.N
  1.8        44         976        K.LTLSALLDGK.N
  1.8        44         986        R.VKPDPPHIK.N
Top scoring peptide matches to query 851
Elution from: 34.75 to 38.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 977528.2 FinneganScanNumber: 2406
Score greater than 29 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 34.5      0.02       -1.50    6   IPI00011569 R.AIGIGAYLVR.L
 14.5         2       -4.77                    R.LKGMSLLVR.A
 14.0       2.2         993                    R.RNSSLLSVR.L
 12.5       3.2       -1.50                    R.ALQIVYGIR.L
  8.5       7.9         993                    R.LAGTIGRSTR.E
  7.0        11       -2.80                    RRWFVLR
  6.8        12         985                    R.KVVQATMVR.D
  6.4        13        8.72                    -.MRRSVLVR.N
  5.4        16      -12.40                    R.GLRVVGLYR.L
  5.4        16         985                    R.IACISLAKR.V
Top scoring peptide matches to query 852
Elution from: 21.82 to 25.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2283220.5 FinneganScanNumber: 1206
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.6      0.51         956        K.VNFHVECK.D
 18.2      0.89      -18.91        R.AVMAAGDGDVK.L
 17.5       1.1         970        -.MASETHNVK.K
 14.0       2.4      -18.88        R.MENANLPTK.Q
 13.6       2.6         966        R.DMLQWDPK.K
 12.9         3         970        -.MSEDPRGPK.V
 12.3       3.5       -0.83        K.DEGASLAENK.R
 11.4       4.3         977        R.ECAHTMRK.R
 11.2       4.5         964        R.TASTPTPDDK.L
 10.3       5.5         953        M.ITDAVDGDAR.E
Top scoring peptide matches to query 853
Elution from: 21.82 to 25.81 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2283220.5 FinneganScanNumber: 1205
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.9      0.61         964        R.TASTPTPDDK.L
 19.5      0.67         970        R.MVVDQGDPR.L
 19.5      0.67         981        K.MDLPDAQDK.F
 19.3      0.71         970        -.MSEDPRGPK.V
 17.6         1         970        -.MASETHNVK.K
 15.6       1.6       -0.83        K.DEGASLAENK.R
 15.0       1.9      -18.89        K.MPQVSQEAK.G
 13.0         3       -0.86        R.LDGSSSGGPEK.R
 11.6       4.1      -18.91        R.AVMAAGDGDVK.L
 11.1       4.6        5.46        -.MAPSGPGSSAR.R
Top scoring peptide matches to query 854
Elution from: 21.94 to 25.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2283220.5 FinneganScanNumber: 1220
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 30.6     0.053      -18.91        R.AVMAAGDGDVK.L
 17.6         1      -18.88        R.MENANLPTK.Q
 16.6       1.3       -0.83        K.DEGASLAENK.R
 16.0       1.5         981        K.MDLPDAQDK.F
 15.9       1.5      -11.73        K.GGSSRESEPK.N
 15.0       1.9         970        -.MASETHNVK.K
 13.3       2.8         966        R.DMLQWDPK.K
 12.9         3        5.46        R.QDQAMTPAR.L
 12.8       3.1         970        R.MVVDQGDPR.L
 11.5       4.2         988        K.EDQEATSPR.L
Top scoring peptide matches to query 855
Elution from: 41.66 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 500519.0 FinneganScanNumber: 3224
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 856
Elution from: 41.52 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1497990.8 FinneganScanNumber: 3202
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 857
Elution from: 41.52 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1497990.8 FinneganScanNumber: 3203
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 858
Elution from: 41.52 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1497990.8 FinneganScanNumber: 3201
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 859
Elution from: 41.52 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1497990.8 FinneganScanNumber: 3204
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 860
Elution from: 35.59 to 39.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8245632.2 FinneganScanNumber: 2520
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 25.8     0.097         972        K.KKLMMLVR.E
 20.2      0.35         983        R.YLSAGRLVR.A
 18.6      0.51         983        R.LKYERAVR.E
 17.9       0.6         972        K.KKLMMLVR.E
 16.1      0.88      -15.49        R.RGVGLALPPR.V
 15.7      0.99         983        R.AHTPAGILVR.G
 12.6         2         958        R.FTAVKTLVR.Q
 12.6         2         983        K.LSFKERVR.M
 12.5         2         983        K.REKAYLVR.S
 12.5       2.1        19.7        R.NHINAVIVR.K
Top scoring peptide matches to query 861
Elution from: 35.59 to 39.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8245632.2 FinneganScanNumber: 2521
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.0      0.73        8.81        R.VQALRHGVR.V
 15.5         1        6.25        K.SILGYNLKK.S
 15.1       1.1         972        K.KKLMMLVR.E
 12.2       2.2         983        R.LKYERAVR.E
 12.2       2.2         972        K.KKLMMLVR.E
 10.8         3         983        K.LSFKERVR.M
 10.3       3.4         983        R.AHTPAGILVR.G
  9.7       3.9        19.7        K.GGVRTPVPPR.G
  9.5       4.1         990        -.MSKLAVLTR.T
  8.9       4.7         979        R.FALPKFGVR.G
Top scoring peptide matches to query 862
Elution from: 35.75 to 39.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8245632.2 FinneganScanNumber: 2547
Score greater than 22 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.5       4.1         968        R.RLLWPPPR.V
  8.6         5        19.7        K.GGVRTPVPPR.G
  8.6         5      -15.49        R.RGVGLALPPR.V
  8.0       5.8      -15.48        K.KKASVHLPR.I
  7.9       5.9        15.8        R.TIFRFVPR.H
  7.2       6.9       -4.62        K.SPXHLSLIR.E
  7.2       6.9       -4.62        K.SPXHLSLIR.E
  6.4       8.3       -4.62        K.FSSLGRIKK.K
  6.2       8.7      -19.37        R.ALLRFLFR.Q
  6.0       9.1         990        R.ASLLLSKMR.T
Top scoring peptide matches to query 863
Elution from: 41.52 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 825330.2 FinneganScanNumber: 3203
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 864
Elution from: 41.54 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 825330.2 FinneganScanNumber: 3205
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 865
Elution from: 41.52 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 825330.2 FinneganScanNumber: 3201
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 866
Elution from: 41.52 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 825330.2 FinneganScanNumber: 3204
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 867
Elution from: 41.62 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1134813.9 FinneganScanNumber: 3220
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 868
Elution from: 35.38 to 39.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1794150.2 FinneganScanNumber: 2487
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 54.2   0.00027       -1.06    2+  IPI00011654 R.YLTVAAVFR.G
 18.0       1.1         968                    -.MTKARLFR.L
 14.8       2.3         951                    R.SSVIHLQVR.V
 14.7       2.4         972                    R.ATFRQLFR.R
 13.7         3         951                    K.VLSNIHTVR.A
 13.3       3.3        16.2                    R.ALTRGHGATR.T
 12.9       3.6        13.6                    R.LPPLLDDTR.D
 11.8       4.7         979                    K.LVPPPSAMAR.S
 11.4       5.1         947                    K.FQFIKSLR.C
 11.2       5.5         973                    K.ATVKYLSEK.W
Top scoring peptide matches to query 869
Elution from: 35.36 to 39.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1794150.2 FinneganScanNumber: 2486
Score greater than 27 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 52.5    0.0004       -1.06    2+  IPI00011654 R.YLTVAAVFR.G
 11.7       4.8       -1.05                    R.FEFLSKLR.H
 11.5       5.1        13.6                    R.LPPLLDDTR.D
 11.3       5.2        9.75                    R.GILIFSDFK.D
 10.7       6.1         947                    K.FQFIKSLR.C
 10.6       6.2         968                    -.MTKARLFR.L
 10.2       6.8         951                    -.LPVRAEPTR.A
  8.5        10        2.84                    K.HKGALEKEK.E
  7.6        12        16.2                    R.ALTRGHGATR.T
  7.2        14         951                    R.SSVIHLQVR.V
Top scoring peptide matches to query 870
Elution from: 35.43 to 39.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1794150.2 FinneganScanNumber: 2495
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 37.1     0.014       -1.06    2+  IPI00011654 R.YLTVAAVFR.G
 16.3       1.7         947                    R.HLAVLNFPK.Y
 14.0       2.9        5.22                    K.MLFLRGFR.S
 13.5       3.2         973                    K.ATVKYLSEK.W
 12.7       3.9        13.6                    R.LPPLLDDTR.D
 11.5       5.1       -1.05                    R.FEFLSKLR.H
 11.4       5.2         986                    R.LEPPGAGRGGK.D
 11.0       5.7         968                    -.MTKARLFR.L
  9.8       7.5         951                    K.KEIRHVEK.K
  8.4        10       -8.00                    K.GSHKTLLQR.M
Top scoring peptide matches to query 871
Elution from: 35.29 to 39.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4122567.8 FinneganScanNumber: 2473
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 20.1      0.75         951    2+  IPI00011654 R.YLTVAAVFR.G
  7.8        13       -3.60                    K.KGLPSPQGTR.K
  6.4        18         972                    R.IRMSLTFR.R
  6.1        19         979                    K.QLGISATGHR.K
  6.1        19        5.93                    R.SPPPPHRPR.L
  5.7        21         983                    R.YNILTLMR.M
  4.3        29      -14.40                    K.ARLSTVHTR.E
  2.4        44        2.71                    K.KIMAHERR.E
  2.2        46        16.7                    K.FYRNALTR.M
  2.1        48       -3.58                    K.VKAEGPGLNR.T
Top scoring peptide matches to query 872
Elution from: 35.90 to 39.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4122567.8 FinneganScanNumber: 2575
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.3       0.7         966        K.GPELDVKGPK.L
  7.7        12         980        K.QLGISATGHR.K
  6.3        17        17.4        R.ATPPAHPPPR.S
  6.1        18         983        R.FLSSMSVLR.G
  5.8        20        17.4        K.LRDWTPPR.L
  5.7        20      -13.68        R.EQVRKQPR.W
  5.7        20        14.2        K.LVSIVHGCR.S
  5.5        21         955        R.LEGAVLAGPGR.H
  5.3        22         983        MSLKFTNAK
  5.2        22         966        K.APDVDIKGPK.V
Top scoring peptide matches to query 873
Elution from: 35.73 to 39.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4122567.8 FinneganScanNumber: 2544
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
  7.5        13       -2.87                    K.VKAEGPGLNR.T
  6.9        15         952                    R.FEFLSKLR.H
  6.6        16         955                    R.RLDGSPLPGK.V
  5.6        20       -6.76                    R.GFPSILGPPR.R
  4.8        25      -13.69                    R.APSVRGAAGVR.G
  4.7        25        7.91                    K.GLVSPQSPQK.S
  3.5        33         952    2+  IPI00011654 R.YLTVAAVFR.G
  2.8        39         983                    R.YNILTLMR.M
  2.8        39         973                    R.IRMSLTFR.R
  2.4        43         955                    K.LDQPANLLR.M
Top scoring peptide matches to query 874
Elution from: 22.60 to 26.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1300418.4 FinneganScanNumber: 1287
Score greater than 29 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.3         1      -12.10        R.NVTAIQGPGGK.W
 15.4       2.5         945        K.GTTSLPSHLK.N
 15.1       2.7         945        K.VLEVNPQNK.A
 15.1       2.7        12.1        M.AAAAGAAAAPGSR.E
 12.5         5       -1.30        K.GPKGTEEPVK.V
 12.2       5.2      -12.07        R.TESRPLPNK.L
 10.8       7.2       -9.51        M.GRAGAGSPGRR.R
 10.8       7.3       -5.80        -.MARQLAHSK.M
 10.7       7.4         945        R.TADGIVSHLK.K
 10.2       8.3        8.22        K.FHSNLPAKAG.-
Top scoring peptide matches to query 875
Elution from: 22.58 to 26.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1300418.4 FinneganScanNumber: 1285
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 20.9       0.7         945                    K.VLEVNPQNK.A
 18.5       1.2       -1.30                    K.GPKGTEEPVK.V
 12.7       4.7         984                    R.ELMDLYLK.M
 12.7       4.7        11.9                    R.FKMFPEVK.E
 12.2       5.3      -19.19                    K.HMTLLADLK.T
 11.8       5.7       -1.30   12   IPI00021304 K.VDPEIQNVK.A
 11.7       5.9        12.1                    M.AAAAGAAAAPGSR.E
 11.6         6       -5.80                    -.MARQLAHSK.M
 10.6       7.6        15.1                    R.FPLFNFEK.G
  9.9         9         945                    K.GQPLQAAVEK.D
Top scoring peptide matches to query 876
Elution from: 32.51 to 36.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2444061.9 FinneganScanNumber: 2177
Score greater than 26 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.3       3.5      -11.73        K.QQIGENLSR.G
 14.0       3.7      -11.74        R.GLAEAGGGVASR.R
 13.0       4.7      -15.59        R.GSFSYKSLR.K
 12.7         5         943        K.QLLDTPNSR.A
 12.6       5.2      -15.60        K.EGVGLWDIR.K
 12.5       5.3         978        K.TGQPGLEGER.G
 12.0       5.9        8.51        K.NFNIHGTNK.H
 12.0       5.9         956        K.FDLMYAKR.A
 11.5       6.7        5.28        K.QLSHMGSIR.E
 10.5       8.5      -18.82        -.MDVNIAPLR.A
Top scoring peptide matches to query 877
Elution from: 32.30 to 36.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2444061.9 FinneganScanNumber: 2156
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.3      0.69        12.2        K.FDIKSFCK.I
 16.2       2.3         945        K.SCKHVVWK.G
 16.2       2.3         956        -.ERPAGDSRR.T
 13.7         4         967        R.NPASLQSGGGR.L
 12.1       5.8       -0.98        K.QGLDPASQTK.V
 10.0       9.3        16.0        -.MKYTTATGR.N
  9.7        10        1.42        K.DLFHCKPK.E
  9.5        11      -15.60        R.FIDNLTGHK.Q
  9.2        11         974        R.EYGKSFGQK.G
  8.9        12         971        R.IDAMDVHVK.A
Top scoring peptide matches to query 878
Elution from: 32.36 to 36.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2444061.9 FinneganScanNumber: 2163
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.1       2.9         956        K.FDLMYAKR.A
 14.7       3.2         943        R.SLKSPPGSDR.G
 12.0         6       -0.96        R.TSPINEDIR.S
 11.4       6.7      -11.73        R.QTALQQEAR.I
 10.9       7.7      -11.73        K.QQIGENLSR.G
 10.8       7.8      -11.73        R.KGKDQPESR.R
 10.7       8.1        8.51        K.NHYVVGAER.K
 10.5       8.4       -0.95        M.ELQGEIEAR.Y
 10.1       9.1         977        R.HTHLNEHR.R
 10.1       9.3         967        M.PRGDSEQVR.Y
Top scoring peptide matches to query 879
Elution from: 34.73 to 38.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 719933.3 FinneganScanNumber: 2405
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.7       1.9       -8.09        K.TSVRKNAIR.F
 14.7       3.9         971        R.SSLRRATPR.H
 12.4       6.5         946        R.QTKGKGVGLR.G
 11.4       8.1         946        K.SSLRNVVLR.D
 10.8       9.4         981        K.ASAEIQRLR.G
 10.6       9.8        16.0        R.RAGSARSALR.T
 10.2        11         978        K.ATVHLAYLR.A
  9.9        12        15.8        R.IAWLLCLR.E
  9.6        12        9.57        K.GLPGLSYLPK.S
  9.5        13         968        K.EILELSALR.R
Top scoring peptide matches to query 880
Elution from: 21.92 to 25.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 1219
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 881
Elution from: 26.91 to 30.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2279760.2 FinneganScanNumber: 1703
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.2         9       -8.33        K.RGAAGGNLSSR.C
 10.7        10        15.7        R.RGSDGGARGGR.H
 10.3        11        2.41        R.RGDEVGSGLR.C
  9.9        12      -15.40        -.MAAARPSLGR.V
  9.9        12      -15.39        R.RQEAMAALR.F
  7.8        20         973        K.QLSHMGSIR.E
  7.2        23         966        K.LDHYGRQR.L
  7.0        24       -1.42        R.AEEKGWGIR.T
  7.0        24        2.43        R.QAADESRIR.R
  6.9        24        2.45        RKQEEEAR
Top scoring peptide matches to query 882
Elution from: 21.08 to 25.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26795591.3 FinneganScanNumber: 1144
Score greater than 30 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.8         2      -15.57        K.LSSAHVYLR.L
 16.4       3.4         953        R.KAALEEVER.L
 15.0       4.8        19.3        R.LWDVRDNK.I
 13.7       6.5        12.2        K.ISMHPFVSK.E
 13.3         7        19.3        K.LFDASHSLR.S
 12.6       8.2         953        K.SISDVASPIR.S
 11.4        11       -8.05        K.LSCPALGISK.R
 10.2        14         953        K.LSITQGNPSK.T
 10.2        14         977        R.KAPSSSSPQR.C
  9.8        16        16.0        R.LGVNDCVLR.V
Top scoring peptide matches to query 883
Elution from: 20.68 to 24.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26795591.3 FinneganScanNumber: 1109
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.7       2.1      -15.56        K.LSSAHVYLR.L
 11.8        10         977        R.KAPSSSSPQR.C
  9.3        18         942        K.REPAQKTSK.I
  8.4        22      -18.79        R.NMIIVVANR.-
  7.2        29        19.3        R.LWDVRDNK.I
  7.2        29         948        R.TPAMKNARR.S
  7.0        30        11.5        R.RMPRCGIR.L
  6.7        32        16.0        K.DKSHVKMGK.V
  6.4        35         953        K.AGANAVDLSVK.E
  6.3        35       -0.95        K.QNSKSVPSAK.V
Top scoring peptide matches to query 884
Elution from: 20.55 to 24.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26795591.3 FinneganScanNumber: 1100
Score greater than 28 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.4       2.2        16.0        K.DKSHVKMGK.V
 14.9       4.9         953        R.KAALEEVER.L
 13.6       6.6         959        R.KACDRPVAK.T
 11.3        11         966        K.QSANLRAER.L
 10.8        13         948        R.TPAMKNARR.S
 10.0        15        19.3        R.LWDVRDNK.I
  8.8        20         942        K.AQITSQQLR.K
  8.3        22       -0.95        K.EQVGSIKER.Y
  8.0        24      -15.56        K.LSSAHVYLR.L
  7.7        26         964        K.AEVVDEIAAK.L
Top scoring peptide matches to query 885
Elution from: 20.53 to 24.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26795591.3 FinneganScanNumber: 1095
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.0       7.6        19.3        R.LWDVRDNK.I
 12.5       8.5      -15.56        K.LSSAHVYLR.L
 12.1       9.3         953        R.KAALEEVER.L
  9.3        18        16.0        R.LGVNDCVLR.V
  9.0        19        11.5        R.RMPRCGIR.L
  8.9        19       -0.97        K.LGELQTTAGR.H
  8.3        22         948        R.AAGVRVGCVR.R
  8.1        23         964        K.AEVVDEIAAK.L
  7.8        25        5.32        R.LRAAQEMAR.K
  7.5        27        16.1        R.AGAMPQAQKK.T
Top scoring peptide matches to query 886
Elution from: 20.48 to 24.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26795591.3 FinneganScanNumber: 1090
Score greater than 25 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.5       4.3        5.32        R.RQEAMAALR.F
 12.0       9.6        19.3        K.QAWASNQLK.A
  9.8        16      -11.70        R.RSEAASGVLR.R
  8.7        20        9.80        R.NVEDISLQK.I
  8.4        22      -18.80        R.LLGAGVSCIR.L
  8.0        24        5.30        R.KERPSCIR.L
  7.4        28       -8.05        VMSIPDVIR
  7.2        29         953        R.IDGPTGQKTK.E
  6.9        31        16.1        -.MNPSPSKIR.I
  6.8        31        12.4        R.REEARAASR.E
Top scoring peptide matches to query 887
Elution from: 26.61 to 30.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1664221.8 FinneganScanNumber: 1670
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.8       9.1         966        K.IQEAASQGLK.F
  9.3        16         966        K.EQIGAAKEAK.K
  8.0        22         980        M.GKVGAGGGSQAR.L
  7.5        24        15.1        K.HFVCQKVK.L
  7.4        25      -12.66        R.LVPQQPHAR.R
  7.4        25         966        R.IDGPTGQKTK.E
  7.3        26        12.7        K.RQVSVEEAK.N
  6.6        30         945        R.RGSLGGALTGR.Y
  5.4        40         956        K.ISGREIDVR.L
  5.4        40         956        K.LSGREIDVR.I
Top scoring peptide matches to query 888
Elution from: 35.12 to 39.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 165870081.4 FinneganScanNumber: 2449
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       8.6         966        K.RSSLSPGRGK.D
 10.9        10        5.24        K.RTIMPGSRK.M
  9.2        15      -11.76        K.VTSDLAKRR.K
  8.9        16         970        R.VGMVQELLR.M
  8.2        19        12.3        R.TVKRGGGASGR.V
  7.9        20        12.3        R.SISRPRSSR.S
  7.7        21        19.2        K.LSSAHVYLR.L
  7.4        23         970        R.LSSCKPPKK.K
  6.5        28         977        K.ISVAGIGASNR.D
  5.8        33         977        R.VDRLSGEIR.L
Top scoring peptide matches to query 889
Elution from: 38.21 to 42.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 93984537.8 FinneganScanNumber: 2957
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.1       4.8         955        K.RSALSAGARR.D
 11.3       9.2         942        K.VRASGDAKIK.K
  7.3        23         966        K.RKEGAGSLAR.F
  6.6        27         977        R.KEKEAAAAAR.T
  5.6        34         962        K.KFETKVHR.K
  4.7        42         977        K.AVNSKAEVAR.A
  4.3        46         973        R.LGLPGEVFGR.S
  4.2        47         973        K.LLSWLQER.A
  3.8        51         973        R.EFKPTLPGR.G
  3.5        54         952        K.HRSFITKR.E
Top scoring peptide matches to query 890
Elution from: 38.17 to 42.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 106846156.4 FinneganScanNumber: 2950
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3        23         973        K.QWGQSLVVK.S
  6.6        27       -0.80        R.SIIGSKGLDR.S
  6.3        29         966        K.QLKESGRAR.W
  5.7        33         973        K.QATFLSLHK.G
  5.5        34         973        R.SYAGVAVIHK.S
  5.4        36         953        K.LLSGEERLK.N
  5.2        37         977        K.NKQEKELR.E
  4.4        45         977        K.AQITSQQLR.K
  4.4        45       -0.77        K.NKEQSKAIK.F
  4.4        45         977        K.GDKAQIEKR.I
Top scoring peptide matches to query 891
Elution from: 37.58 to 41.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 165771836.6 FinneganScanNumber: 2861
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.0       7.7         977        K.NSASVGIIQR.D
 10.8        10       -0.78        K.KTNLIVDSR.E
  9.0        15        19.4        K.SAFLQVQPR.E
  8.5        17        16.2        K.IDLEIRMR.E
  7.1        24         970        K.TGLKELPMR.N
  6.5        28       -0.78        R.TQDLTAKLR.K
  6.1        30      -15.39        R.FNVAITRPK.A
  5.8        32         977        M.RDEDKLLR.I
  5.7        33        5.48        -.MSSLPRRAK.V
  4.4        45      -11.52        R.SALTRALASR.T
Top scoring peptide matches to query 892
Elution from: 35.18 to 39.17 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 165771836.6 FinneganScanNumber: 2458
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.1        48      -15.25        K.AFNKNVPKK.K
  4.0        48       -0.64        R.RKEVLDASK.A
  3.5        55         942        K.VRASGDAKIK.K
  0.2   1.2e+02         966        K.RKEGAGSLAR.F
Top scoring peptide matches to query 893
Elution from: 35.32 to 39.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 165771836.6 FinneganScanNumber: 2477
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.2        37         973        K.ARRMAANVR.E
  4.0        49         943        K.VRASGDAKIK.K
  3.6        53         953        K.VSVPSTVISR.V
  3.0        61       -0.35        R.SIIGSKGLDR.S
  2.9        63         977        K.ISGREIDVR.L
  2.9        63         977        K.LSGREIDVR.I
  2.0        77         977        R.KEKEAAAAAR.T
  0.7   1.1e+02      -18.17        K.MPLGKLSKR.Q
  0.0   1.2e+02         977        R.DTVVEGLRR.L
Top scoring peptide matches to query 894
Elution from: 35.53 to 39.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 165771836.6 FinneganScanNumber: 2512
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.5        42         953        R.SSIQLQAVAK.C
  3.7        50         953        K.SIDLVLAASR.E
  3.0        59         974        R.EFKPTLPGR.G
  3.0        59         963        K.KFETKVHR.K
  2.8        62        6.03        R.LGLGLRMNR.T
  2.0        75         978        K.ISGREIDVR.L
  2.0        75         978        K.LSGREIDVR.I
  1.8        78         953        K.SAVQAALEKK.K
  1.6        83        10.6        K.SKEIAIEQK.E
  1.2        89       -7.31        K.EVVVSMLLR.L
Top scoring peptide matches to query 895
Elution from: 36.05 to 40.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1432508.2 FinneganScanNumber: 2598
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 896
Elution from: 37.58 to 41.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10498755.2 FinneganScanNumber: 2861
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 897
Elution from: 37.61 to 41.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10380123.8 FinneganScanNumber: 2864
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.3        23         970        K.QKFVALVSR.R
Top scoring peptide matches to query 898
Elution from: 37.71 to 41.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10121161.9 FinneganScanNumber: 2883
Score greater than 16 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5       7.1         967        -.MIVSGKKLR.L
  3.3        12         970        R.LLGQKFSVR.A
  3.1        12        5.57        K.GPELPLVPVK.R
  0.0        25        18.9        R.KHPEVLAVR.I
Top scoring peptide matches to query 899
Elution from: 22.43 to 26.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2585244.3 FinneganScanNumber: 1267
Score greater than 17 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.6      0.72         963        K.VLSILLKHK.K
Top scoring peptide matches to query 900
Elution from: 22.45 to 26.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2585244.3 FinneganScanNumber: 1271
Score greater than 17 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.2       2.5        3.74        R.VLLRRPVAK.E
Top scoring peptide matches to query 901
Elution from: 23.37 to 27.39 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2178907.7 FinneganScanNumber: 1352
Score greater than 17 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.2       2.1         963        K.VLSILLKHK.K
Top scoring peptide matches to query 902
Elution from: 36.15 to 40.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1304944.6 FinneganScanNumber: 2618
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 903
Elution from: 29.48 to 33.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6306422.4 FinneganScanNumber: 1915
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.5         5      -11.47        R.TSEHQVDLK.V
 11.3       5.3         966        -.MQKMNPYK.I
  9.8       7.5       -5.28        -.MHDSRGIPK.H
  9.8       7.5         949        R.AASPSGPPPMK.I
  9.1       8.9      -11.44        K.AENPEQQLK.Q
  8.9       9.1      -11.45        R.DLRTSSYSK.S
  8.7       9.6       -4.61        K.EVLEEYFK.Y
  8.5        10      -12.72        R.EGGGWARPAR.A
  8.4        10        14.7        R.NVQHYHMK.T
  8.1        11      -18.45        K.MKYDKDIK.K
Top scoring peptide matches to query 904
Elution from: 29.52 to 33.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6306422.4 FinneganScanNumber: 1918
Score greater than 28 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.4       1.6      -18.46        K.TSALMDKFK.H
 14.9       2.3         942        MAMVSEFLK
 14.4       2.6      -12.72        R.EGGGWARPAR.A
 13.9       2.9         949        R.HESMPDVLK.I
 12.5         4      -11.46        R.TSEHQVDLK.V
 12.5         4        1.56        -.MWIYSVNK.E
 12.2       4.3         932        M.ATALDPDQPK.K
 11.0       5.7      -11.44        K.AQAAEVPNEK.C
 10.7       6.1       -4.61        K.EVLEEYFK.Y
 10.3       6.7        1.55        R.CVPYFKDK.G
Top scoring peptide matches to query 905
Elution from: 29.60 to 33.57 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6306422.4 FinneganScanNumber: 1924
Score greater than 25 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.2       4.4      -11.45        K.ALDAISHSDK.G
 11.9       4.6       -5.28        -.MHDSRGIPK.H
 11.5       5.1      -18.46        K.TSALMDKFK.H
 11.2       5.4      -11.46        R.TSEHQVDLK.V
 11.2       5.5       -4.61        K.EVLEEYFK.Y
 10.1         7      -11.44        K.AQAAEVPNEK.C
 10.0       7.2        1.55        R.CVPYFKDK.G
  9.9       7.3         942        R.MMQIEFIK.Q
  9.9       7.3         942        R.MMQIEFIK.Q
  9.5         8        14.7        R.NVQHYHMK.T
Top scoring peptide matches to query 906
Elution from: 23.94 to 27.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 760989.9 FinneganScanNumber: 1393
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.9         2      -14.85        -.MEPVQQAEK.T
  8.8       6.3      -18.50        K.GSDSSPTPRR.S
  8.8       6.4         932        M.WGDSRPANR.T
  7.7       8.2         968        K.AAEEAEPADR.S
  7.1       9.4       -1.07        R.SEGFYTIDK.K
  7.0       9.6      -16.13        R.MQNHFGAVR.S
  6.9       9.9         933        K.ASDAAPNLDGK.S
  6.2        12         956        R.GMGIPGPGCGR.V
  6.0        12      -18.47        R.ERNGEAIDR.S
  5.9        13         939        R.EVNMHSSVR.Y
Top scoring peptide matches to query 907
Elution from: 23.67 to 27.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 926858.6 FinneganScanNumber: 1370
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.9       2.6         952        -.MENPRCPR.R
  9.2       4.9         929        R.ADRDTAADPK.E
  9.1       4.9         949        K.QVMMFSATL.-
  9.0       5.1       -2.21        K.DGHYDARAR.V
  7.6         7      -11.54        K.DRDSANSAPK.T
  6.5         9      -11.56        R.SPSSQTPNSR.R
  5.9        10         935        K.VHMKDGSNR.L
  5.1        12      -18.54        K.DIQMPDGIR.R
  5.1        13       -7.93        K.IAELCDDPK.E
  4.8        14       -1.76        K.MTYQKMAR.A
Top scoring peptide matches to query 908
Elution from: 35.10 to 39.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2589399.7 FinneganScanNumber: 2445
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 82.0   5.5e-07       -1.21    1   IPI00301263 R.MALLATVLGR.F
 27.7      0.15         942   21   IPI00440016 K.TEKWALLAK.K
 27.0      0.17        1.99   22   IPI00169307 R.FAILKESPR.S
 27.0      0.17        4.52                    R.FAQRNLRR.D
 26.9      0.18       -1.21                    K.LLDMKLVGR.N
 25.9      0.23      -19.22                    K.NAFRKVIGR.K
 24.0      0.36       -1.22                    R.MVSLLGVAVR.E
 21.4      0.64         928                    K.GVMRVGILAK.G
 21.3      0.66        15.1                    R.KSYTHIRR.I
 21.2      0.67         941                    -.MGLARALRR.L
Top scoring peptide matches to query 909
Elution from: 35.06 to 39.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2589399.7 FinneganScanNumber: 2438
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 92.7   4.7e-08       -1.21    1   IPI00301263 R.MALLATVLGR.F
 36.9     0.018         942   21   IPI00440016 K.TEKWALLAK.K
 36.8     0.018        1.99   22   IPI00169307 R.FAILKESPR.S
 28.6      0.12         928                    K.GVMRVGILAK.G
 28.3      0.13        4.52                    R.FAQRNLRR.D
 26.0      0.22      -19.22                    K.NAFRKVIGR.K
 24.3      0.33         935                    R.DTSRRLLAK.K
 24.3      0.33         950                    K.MEELLLLAK.E
 21.8      0.58       -7.36                    R.LLLSTSLDAK.D
 21.0       0.7       -1.21                    K.LLDMKLVGR.N
Top scoring peptide matches to query 910
Elution from: 35.01 to 39.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2589399.7 FinneganScanNumber: 2430
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 51.3   0.00065       -1.21    1   IPI00301263 R.MALLATVLGR.F
 21.8      0.58         928                    R.SMVPTKKLR.K
 20.9      0.71      -19.22                    K.NAFRKVIGR.K
 20.6      0.77        1.99   22   IPI00169307 R.FAILKESPR.S
 20.0      0.89         935                    R.DTSRRLLAK.K
 19.0       1.1         946                    R.ETTKRPSLK.T
 17.9       1.4         950                    K.MEELLLLAK.E
 17.9       1.4         942   21   IPI00440016 K.TEKWALLAK.K
 16.4         2         946                    M.SISRAVLGEK.E
 16.0       2.2         946                    R.VSSAVKAELR.Q
Top scoring peptide matches to query 911
Elution from: 20.32 to 24.32 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 608756.0 FinneganScanNumber: 1078
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.6       5.1         933        R.TMLHSLMGR.L
 10.3       8.6         960        M.AQHGAMGAFR.A
 10.1         9       -8.65        K.EAQKEGWSK.A
  9.3        11        4.90        K.TNMMTHLSK.I
  8.8        12         930        -.XEAFEAIPR.A
  8.8        12         934        K.ENNLDLTSR.F
  7.4        17         929        K.GKCVRNGDR.F
  5.6        25         950        K.AQEMEAAVGR.L
  5.4        27      -18.79        K.MPDAGMLSIK.M
  5.0        29         936        R.MGGSWSALXR.V
Top scoring peptide matches to query 912
Elution from: 35.41 to 39.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 49791384.8 FinneganScanNumber: 2493
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.7       1.8         957        K.FANLAGLLSR.Q
  9.4       7.7         957        R.DIIFELRR.I
  8.7       9.1         957        K.FALNSLLQR.Q
  8.7       9.1         943        K.RKASLAMLR.A
  7.4        12        14.9        -.MLSLSSLRR.N
  7.4        12        18.1        R.SSRIFPSLR.R
  7.2        13         960        K.SVVGTSSLRR.A
  7.2        13         943        K.RLQIMTKR.Y
  7.0        13        5.00        -.XFLIETGLAK.D
  7.0        13         964        K.MAKLASELAK.T
Top scoring peptide matches to query 913
Elution from: 35.53 to 39.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 49791384.8 FinneganScanNumber: 2511
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.7        11        15.3        R.RILMGSTLR.K
  7.2        13       -8.43        R.MRSVLISLK.Q
  6.5        15         950        K.MVSVLPIFR.S
  4.9        22         936        R.LFRRGSLGR.W
  3.9        28        15.3        R.SLKGKLMNR.A
  3.1        33        15.3        R.LAAMSKASRK.F
  3.1        33        18.4        K.LQGSLGRFGK.T
  3.0        34        11.5        K.MKLSWIIR.I
  2.9        34        18.9        K.LKPKMVTMV.-
  2.9        34         946        M.FSPLKSRAR.A
Top scoring peptide matches to query 914
Elution from: 36.06 to 40.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 49791384.8 FinneganScanNumber: 2602
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.9        28        15.3        R.RILMGSTLR.K
  3.0        34        5.37        K.EFVTAVVLGK.D
  2.9        35       -5.16        K.KELQILYR.G
  2.8        35        18.5        K.LALQLHPDR.N
Top scoring peptide matches to query 915
Elution from: 38.14 to 42.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 35075606.8 FinneganScanNumber: 2946
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.9        11        16.0        R.SLKGKLMNR.A
  6.6        15       -7.71        K.LTLALKMTR.Q
  5.3        20         965        K.EVVVSMLLR.L
  5.2        20       -4.55        K.IFGLTKDLR.V
  5.2        21       -4.53        K.KISKNPTFK.L
  4.8        22        4.78        K.LHLWPQLR.W
  4.8        22         938        K.KLSELTSRK.A
  4.5        24      -15.12        R.GLLPGLSHLR.L
  4.0        27      -15.12        R.LSLVHGAPIR.E
  3.8        28         944        K.RKASLAMLR.A
Top scoring peptide matches to query 916
Elution from: 38.24 to 42.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 23615612.4 FinneganScanNumber: 2964
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.1       6.5         958        K.FALNSLLQR.Q
  9.9       6.9      -15.09        R.SLLLNPHLR.Q
  8.7       9.1        19.2        R.GPPGLAGAPGLR.G
  8.5       9.6         958        K.AFVKALEQR.F
  7.0        14        19.2        R.APPAAAALPGAR.Y
  6.9        14         958        R.LLPPAGPGSPR.L
  6.7        14         931        K.VKMTTPLKK.L
  6.7        15         958        R.IAFLQGERK.G
  2.5        37        16.0        K.ERKMITIR.G
  2.2        40         965        K.LMLDLNKAK.S
Top scoring peptide matches to query 917
Elution from: 19.25 to 23.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1649397.7 FinneganScanNumber: 1012
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 35.6     0.027        19.6   23   IPI00745955 K.QAAMERSEK.A
 24.1      0.38      -14.64                    K.KATNCKTDK.N
 21.4      0.72         939                    K.GLSSTEQTNK.S
 19.3       1.1         939                    K.KETSESQKQ.-
 19.1       1.2        8.98                    R.SSRQCTGAAK.N
 16.9         2        2.86                    R.GSLDSSRSEK.D
 16.6       2.2      -18.41                    K.QMYPSIQAK.I
 16.5       2.2         955                    R.GTADDMLAVR.L
 16.0       2.5      -18.40                    K.AKEWEMKK.T
 15.4       2.8         955                    K.SGLCSEAAAAK.T
Top scoring peptide matches to query 918
Elution from: 19.22 to 23.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1649397.7 FinneganScanNumber: 1008
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 18.9       1.3      -18.40                    K.AKEWEMKK.T
 18.4       1.4         955                    K.SLGAEMDSVR.S
 16.9         2      -14.64                    K.KATNCKTDK.N
 14.7       3.3        2.06                    R.AQMAALAAMR.A
 13.2       4.7         939                    M.SDANLDSSKK.N
 12.9         5        19.6   23   IPI00745955 K.QAAMERSEK.A
 12.6       5.3       -4.08                    K.AKEIDSMQK.Q
  9.6        11         955                    R.GTADDMLAVR.L
  9.4        11       -4.08                    K.AKQLMSDEK.C
  8.6        13      -18.41                    -.MAPLYQAAGK.G
Top scoring peptide matches to query 919
Elution from: 37.74 to 41.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1973512.8 FinneganScanNumber: 2889
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.7       4.5        18.5        K.TAALVLHGRK.Q
  3.4         6         944        R.SIHILLGRR.D
  3.1       6.4        8.00        R.IPASPRLRR.V
  1.7       8.9         954        R.GKKHVPSALK.E
  1.6       9.1      -15.67        R.VAARVVVPVR.S
  0.2        13         931        R.HDKIVIVLK.N
  0.0        13       -5.09        R.HKIVISIQK.L
Top scoring peptide matches to query 920
Elution from: 20.78 to 24.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1206439.4 FinneganScanNumber: 1119
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 24.9      0.33        19.9        K.EASRFSAGSR.I
 21.1      0.78        12.9        -.MATTNFNLR.L
 18.4       1.4        10.6        R.SSSLKSSSER.N
 18.0       1.6         927        R.SQSVKMKDK.L
 16.7       2.2      -14.24        R.NSDLNVHLR.V
 16.5       2.3         930        K.TDNLTSFIR.Q
 15.5       2.9         954        R.RDFESEKR.L
 15.4       2.9       -8.76        K.RFTFGFHR.L
 13.8       4.2        16.7        K.RMKASESSR.L
 13.5       4.5        6.19        K.MRRSSTASR.C
Top scoring peptide matches to query 921
Elution from: 20.66 to 24.64 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1206439.4 FinneganScanNumber: 1106
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.1       3.1       -8.76        K.RFTFGFHR.L
 11.3       7.4        10.6        R.SSSLKSSSER.N
 11.0         8         954        R.RENYLSER.R
 11.0         8         943        K.RESYARER.S
 10.9       8.2       -3.72        R.VTPQEPPGSR.I
 10.8       8.3        19.9        K.GSAARSFSER.E
 10.8       8.4        16.7        K.RMKASESSR.L
 10.8       8.4        19.1        K.RMKQWMR.R
 10.8       8.4         926        K.RMTSPFRR.L
 10.4       9.3        13.0        -.MAPAPQAPER.D
Top scoring peptide matches to query 922
Elution from: 35.63 to 39.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5320727.0 FinneganScanNumber: 2529
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.3       6.7         930        R.SKDITSLFR.H
  3.9        37        5.44        K.MKNGLMFVK.L
  3.6        40         953        R.ALGEGAGPAAPR.L
  2.1        56         956        R.GHNARAERR.R
  1.6        62       -1.76        R.AHGQKNTRR.D
  1.0        71      -11.21        R.TDFIKGMKK.K
  0.9        73         943        K.NGQIHRDVK.A
  0.6        79         943        R.GGPVPAAREGR.M
  0.4        82        6.26        K.GPSASAALSPPL.-
  0.2        86        8.73        R.RGGVPGGTGGPR.G
Top scoring peptide matches to query 923
Elution from: 36.05 to 40.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4402243.3 FinneganScanNumber: 2599
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9        12         961        K.AMATKAKSDK.W
  6.6        20         954        K.EGYKSAQKR.A
  4.5        32         954        K.TDSRGYLVR.S
  4.5        32         961        K.AFAFSPDLAK.H
  4.1        35         929        R.ANWVRAPPR.G
  3.5        40         941        R.LTVGVYESAK.L
  3.2        43         930        K.SYTTPKKNK.H
  2.8        47        2.31        -.MNSLFRKR.N
  2.6        49         930        K.AEPVEVVAPR.G
  1.6        62         950        K.FPVNFLSSR.T
Top scoring peptide matches to query 924
Elution from: 35.96 to 39.96 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4402243.3 FinneganScanNumber: 2586
Score greater than 23 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.9       7.3         954        K.TDSRGYLVR.S
 10.6       7.8        12.8        CGYGKINKK
  9.5        10         954        K.EGYKSAQKR.A
  8.7        12       -3.83        K.EGPRTPVPSK.Y
  8.1        14         930        K.NPAAPLGAVEK.I
  5.8        23        19.8        K.AERFSSRSK.A
  5.2        27        5.46        K.IRVWHDNK.G
  5.2        27        5.46        LRVWHDNK
  4.3        34       -3.81        R.KDLFSSRSK.L
  3.4        41         954        K.IPAEKESHR.D
Top scoring peptide matches to query 925
Elution from: 21.51 to 25.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 432463.0 FinneganScanNumber: 1177
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.2       3.4      -11.30        R.GQDPGAQPWL.-
 10.2       5.6         926        R.ENGSFSGKNK.S
  9.6       6.4        19.7        R.YGAELEACR.C
  8.5       8.1      -14.43        MGNSYAGQLK
  8.1         9         955        K.VQGCHHSSR.K
  7.7       9.9       -8.78        M.GWGHGGREGR.R
  6.8        12         926        R.SDPNHSLQGI.-
  6.3        13       -3.91        R.MSFDAELQK.L
  6.1        14       -0.96        K.DLCMKVMR.E
  4.2        22        10.4        K.ETTLGDMTGK.C
Top scoring peptide matches to query 926
Elution from: 21.53 to 25.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 432463.0 FinneganScanNumber: 1180
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.8       0.6      -11.30        R.GQDPGAQPWL.-
  8.6       8.1      -17.57        K.KKEMGNSMK.S
  7.5        10         926        R.ENGSFSGKNK.S
  7.0        11      -18.06        R.TQAGGHGVGER.L
  6.3        14        3.01        R.DSPSYGSLSR.G
  6.0        15      -14.46        K.AGVLFGMSDR.G
  5.4        17         926        K.ENNSPEHLK.D
  5.3        17        9.13        R.NECGKAFSR.K
  4.2        22       -3.92        K.FILSCADDK.T
  2.0        36         926        R.ATQGTYSPSR.Q
Top scoring peptide matches to query 927
Elution from: 34.26 to 38.24 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1200345.5 FinneganScanNumber: 2342
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.0       5.7         941        R.MTPPVANPNK.N
 11.6       6.4        19.2        R.MSNSFTAIAK.L
 11.1       7.2         924        K.AAHLEGTELK.H
 10.9       7.4      -14.86        -.MTKGTSLFGK.R
 10.1         9         944        K.AFVEATFQR.Q
  9.5        10        19.2        K.SIVMAFSGNK.D
  9.2        11      -14.83        K.SFKTEKAMK.N
  9.1        11         941        R.RPSYTLGMK.S
  9.0        12         951        K.MGFGGTLEIK.T
  8.9        12        2.58        R.TSTDYLLTR.L
Top scoring peptide matches to query 928
Elution from: 21.72 to 25.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2257354.7 FinneganScanNumber: 1193
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 23.3      0.44         921        K.AQTGPPRVDK.M
 19.3       1.1       -0.77        K.EKEASHQLK.L
 16.8         2         925        K.EKKMEYLK.E
 16.2       2.2         951        R.YPVHGPVDGK.T
 13.2       4.5         955        K.EEQEHLRK.L
 12.1       5.7       -0.82        R.GGLGSPGPKGDK.G
 10.3       8.6         959        R.EMFDKASLK.L
  9.9       9.6       -7.70        -.MTSAQYKIK.I
  9.6        10         921        R.GSLVPQAGPSR.A
  9.2        11         925        K.MLISAGGYIK.W
Top scoring peptide matches to query 929
Elution from: 22.42 to 26.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 771023.9 FinneganScanNumber: 1266
Score greater than 21 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.3       6.6      -17.33        K.SHSSLEGLLK.A
  8.1        14      -17.34        R.KPASAVGTPDK.A
  7.1        18        16.7        R.NVPADALDQK.V
  3.3        42      -18.58        R.GPASXLQRR.G
  3.1        44        12.3        R.EPRPCQRK.R
  2.9        46         934        K.DGYILGIYR.I
  2.6        50         947        R.HGLGTQPGFR.T
  2.5        50        15.4        R.SPQRPGWSR.S
  2.5        51         954        K.MNGKAYNKK.T
  2.4        51         957        R.SKPYFQSGR.S
Top scoring peptide matches to query 930
Elution from: 22.81 to 26.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5684738.1 FinneganScanNumber: 1309
Score greater than 29 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.1       1.2         919        R.LLSPAREER.G
 15.8       2.6         949        R.EPSINHFVK.K
 13.7       4.3      -11.36        K.NLSPRVTER.D
 11.7       6.7      -11.36        K.KLGAQASPGSR.Q
 11.6       6.8       -0.87        R.KAVPDAVESR.Y
 10.5       8.9         928        R.GPASXLQRR.G
 10.1       9.6       -0.86        K.NGAALVLEER.T
 10.1       9.8        8.38        K.RFSQKYSR.L
  8.7        13         935        K.LWKSFFSR.S
  8.5        14       -0.87        K.QADVNLVNAK.L
Top scoring peptide matches to query 931
Elution from: 22.73 to 26.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5684738.1 FinneganScanNumber: 1299
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.8      0.81       -0.87        K.QADVNLVNAK.L
 14.1       3.8       -7.78        R.VVPPASNMLK.M
 10.8       8.3       -7.76        R.ELATLLHMK.D
 10.4         9        15.7        R.LALPSAPSCR.R
 10.3       9.2      -11.34        K.GAADAIAQAKR.R
  9.8        10       -0.85        R.LNDELQALR.D
  9.5        11      -11.36        K.NIPRITSDR.L
  9.3        11      -15.15        K.LTVTTPFHR.D
  8.9        13       -0.88        R.QAGLLTTDPR.V
  8.4        14        5.86        K.VVAIYDYTK.D
Top scoring peptide matches to query 932
Elution from: 22.62 to 26.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5684738.1 FinneganScanNumber: 1292
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.8      0.66        18.9        K.KPSGPEPGFR.L
 19.0       1.2       -4.62        K.IPSLGWSPSK.H
 16.1       2.4      -11.35        K.KLGAQASPGSR.Q
 10.8       8.2       -0.88        K.QQGVLQSSPK.N
  9.7        11       -0.85        K.NGAALVLEER.T
  9.4        11      -11.35        R.LNREDLGVR.D
  8.8        13        15.7        R.LALPSAPSCR.R
  8.4        14       -0.85        K.LLGELNEQR.K
  8.3        15       -0.86        R.KAVPDAVESR.Y
  7.8        17      -11.35        K.NLSPRVTER.D
Top scoring peptide matches to query 933
Elution from: 36.38 to 40.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2767389.0 FinneganScanNumber: 2655
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 74.4   4.6e-06        1.54    1   IPI00301263 R.LSLDDLLQR.L
 37.6     0.022         944   20   IPI00456492 R.AQLQSQLQR.E
 26.8      0.26       -8.93                    K.NGKEEVIKR.K
 26.6      0.28       -8.92                    K.AEEAKKLAGR.A
 25.3      0.37       -8.93                    K.SLLDNLRNK.V
 23.0      0.63        14.5                    R.SLDRQGIQR.A
 22.4      0.72         921                    K.LNIDSIIQR.L
 20.4       1.1        1.55                    K.LSLLLDNER.W
 20.2       1.2       -8.92                    K.AENASLAKLR.I
 18.9       1.6       -8.92                    R.LEREELKR.K
Top scoring peptide matches to query 934
Elution from: 36.36 to 40.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2767389.0 FinneganScanNumber: 2653
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 60.7   0.00011        1.54    1   IPI00301263 R.LSLDDLLQR.L
 32.5     0.071         944   20   IPI00456492 R.AQLQSQLQR.E
 28.4      0.18        1.55                    K.LSLLLDNER.W
 25.7      0.34        1.55                    K.TQAELLLER.L
 21.4      0.92         921                    R.ALLEQTLQR.A
 20.8         1       -8.92                    K.AEEAKKLAGR.A
 20.8         1        14.5                    R.SLDRQGIQR.A
 20.6       1.1        1.54                    R.SVLQEVLER.M
 20.6       1.1       -8.93                    K.NGKEEVIKR.K
 20.5       1.1      -19.45                    K.RTGTGTPVKR.V
Top scoring peptide matches to query 935
Elution from: 37.25 to 41.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6724664.7 FinneganScanNumber: 2805
Score greater than 21 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8        24         937        R.SLAVAHAAVHP.-
  8.3        28         948        IHTGEKPYK
  8.3        28         948        LHTGEKPYK
  6.2        44         918        R.LKEEIERR.R
  5.9        48         918        K.VKLVNAGSER.L
  5.5        53         931        K.VKSGQNRQR.S
  5.4        53       -0.56        K.VEGITNQGKK.A
  4.8        62      -17.92        R.LQGVERIMK.K
  4.4        67         941        R.DGAGLLRQSR.E
  3.8        78      -11.02        R.GSRAALLTER.T
Top scoring peptide matches to query 936
Elution from: 37.54 to 41.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6724664.7 FinneganScanNumber: 2852
Score greater than 14 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.3   1.4e+02         934        R.MSIPEALRR.H
  1.0   1.5e+02      -17.89        -.MAALLAAAAVR.A
  0.6   1.6e+02        9.95        K.ASNVLEEIAK.D
  0.3   1.7e+02         918        R.LKAINDTAAR.L
  0.1   1.8e+02         941        R.QENLLGSRR.S
Top scoring peptide matches to query 937
Elution from: 37.43 to 41.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6724664.7 FinneganScanNumber: 2837
Score greater than 13 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.5   1.6e+02       -0.54        R.NLTNLASNVK.I
  0.2   1.8e+02         937        K.GLPGPAGPPGPR.G
Top scoring peptide matches to query 938
Elution from: 37.68 to 41.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6724664.7 FinneganScanNumber: 2880
Score greater than 19 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.5        33        16.0        R.MAIAPSAGALR.G
  5.7        50        9.95        K.ASNVLEEIAK.D
  4.7        63       -0.55        R.VSGSEKITPR.W
  4.5        66        12.5        K.ERSQELRR.L
  4.2        71        12.4        R.REEVATGRR.A
  4.0        74        5.54        K.LKHMGKSTR.R
  3.9        76         931        R.AGRRSEQLR.E
  3.8        78       -0.55        R.IKQVDLDSR.H
  3.8        78       -0.55        R.LQQLTEVSR.R
  3.1        90       -0.54        R.KLTSPRTAEA.-
Top scoring peptide matches to query 939
Elution from: 20.70 to 24.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 280868.3 FinneganScanNumber: 1110
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 51.0   0.00094       -0.86    9   IPI00029446 R.SALDVASEQR.R
 29.9      0.12       -0.83                    K.KKEEEQER.L
 23.0      0.59       -0.85                    K.EEKVSEAQR.V
 22.8      0.62         916                    R.RVEEEKER.A
 21.6      0.81      -18.20                    -.MAAPAVSGLSR.Q
 21.6      0.81      -18.20                    -.XAAPAVSGLSR.Q
 20.0       1.2       -0.83                    K.EEEEKQKR.L
 20.0       1.2         925                    R.QAWEAGRTR.K
 20.0       1.2       -0.85                    R.QEEKESLGR.E
 19.3       1.4        5.22                    R.QEIDRMQR.V
Top scoring peptide matches to query 940
Elution from: 37.81 to 41.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3370082.9 FinneganScanNumber: 2901
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        12         950        K.LKKTVTNDR.S
  3.2        25         923        R.KLEIKSFPL.-
  2.4        30         950        R.LVKSGSLGSAR.G
  1.7        36         925        R.HLSRPLPVR.R
  1.1        42         936        R.VRIAYPSLR.E
Top scoring peptide matches to query 941
Elution from: 37.78 to 41.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3370082.9 FinneganScanNumber: 2895
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.7       9.1         950        R.LVKSGSLGSAR.G
  6.5        12         950        R.LVASSKINSR.S
  5.5        15         953        R.EIKLVSILC.-
  5.1        16         950        K.LKKTVTNDR.S
  3.8        22         950        R.RSQIKTDVK.K
  3.5        23         946        K.NKVNVFGAII.-
  3.5        23         950        K.SSVLKGIQSR.E
  3.2        25         923        R.KLEIKSFPL.-
  3.2        26         950        K.KISQSTALAR.S
  0.7        45        16.0        K.MKILSNLTR.L
Top scoring peptide matches to query 942
Elution from: 37.74 to 41.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3389538.4 FinneganScanNumber: 2890
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.2        25        8.61        R.FGGISVRLAR.L
  3.0        26         933        R.RKLELIMR.A
Top scoring peptide matches to query 943
Elution from: 16.79 to 20.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 838088.8 FinneganScanNumber: 858
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 23.3      0.47        6.27                    R.IPSTEDLMR.G
 20.2      0.97       -1.02    2+  IPI00011654 K.IREEYPDR.I
 15.8       2.7        15.4                    R.GPGSFPXNMR.E
 11.6         7        2.70                    R.RNDTLDSTR.T
  9.5        11       -4.15                    R.RIIEEMDR.R
  8.7        14        1.89                    R.QVPGMARMR.L
  8.7        14      -11.49                    R.SPPPGAQGGGPR.D
  8.2        15        19.2                    R.RNQEMQQK.L
  8.0        16        1.28                    K.RMFGTYFR.V
  7.9        16         941                    K.GPDPLQYMR.A
Top scoring peptide matches to query 944
Elution from: 16.79 to 20.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 838088.8 FinneganScanNumber: 856
Score greater than 31 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 21.6      0.71       -1.02    2+  IPI00011654 K.IREEYPDR.I
 17.2       1.9        8.75                    K.RGSSCQGLGR.S
 16.1       2.5        6.27                    R.IPSTEDLMR.G
 14.6       3.5         937                    R.SPYSSRHSR.S
 12.6       5.6        19.2                    R.EDMQRLNR.D
 12.5       5.7        15.4                    R.GPGSFPXNMR.E
 12.2       6.1        1.28                    K.RMFGTYFR.V
 11.5       7.2      -11.46                    K.RLGWSESSR.I
 10.9       8.2         941                    K.GPDPLQYMR.A
  9.8        11         924                    K.KDFPEGDIR.L
Top scoring peptide matches to query 945
Elution from: 16.55 to 20.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1030910.7 FinneganScanNumber: 841
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 35.1     0.041       -1.17    1   IPI00301263 SVHICHVAR
 20.3       1.2        19.7                    R.ECFLPSVAR.T
 15.1       4.1         931                    R.VSSSGLDSLGR.Y
 13.4         6        13.0                    R.NAVSASMRSR.G
 12.9       6.8        17.4                    R.EGSSTLSEIR.K
 11.4       9.6         941                    R.SPPPGAQGGGPR.D
  9.7        14       -7.22                    R.GQASSFPTRK.E
  9.7        14         931                    K.EGTSTLQSVR.R
  9.5        15         917                    M.FGIQESIQR.S
  9.5        15         917                    R.KGSSELGFPR.V
Top scoring peptide matches to query 946
Elution from: 36.49 to 40.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1452120.7 FinneganScanNumber: 2675
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8         7        9.34        K.MARVFSVLR.E
  7.7        12        5.77        K.RHQVNGLVR.R
  6.0        17         947        R.NPFVQVFVK.F
  2.4        39         941        R.ASPHAGVILGR.R
  2.0        43         941        K.KRSSLFSPR.R
  1.8        45         951        K.FLDAQKVTR.Q
  1.7        45         917        K.EFVARIKSK.L
  1.7        45        19.8        R.LVCASLFLR.L
  1.7        45         917        K.TPPKSPVVPR.R
  1.6        46         941        K.VFLSRTAQR.I
Top scoring peptide matches to query 947
Elution from: 36.50 to 40.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1452120.7 FinneganScanNumber: 2677
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.3         2         941        R.LTHPNVVAAR.D
 10.2       6.5        13.7        R.LDSLTFLAAK.A
  9.6       7.4       -7.13        K.LAGLHDAILR.M
  9.3       7.9         951        R.LGQVASSLFR.G
  8.2        10        10.6        R.ITVLETKMK.Q
  7.3        12        16.2        K.ALRDPHTLR.A
  7.2        13         948        R.GSLLGSMKLR.K
  6.6        15        16.2        K.DLLYRRSR.S
  6.5        15       -7.13        R.LQLHLGEIR.G
  6.3        16         951        R.TRPAEKTFK.Q
Top scoring peptide matches to query 948
Elution from: 35.38 to 39.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15256811.0 FinneganScanNumber: 2490
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.3       4.7         932        R.ALPPGLRAQR.A
  8.0         5         921        R.HRRILVER.N
  7.2         6         932        R.RSVLLPTHR.R
  4.0        13         942        K.ISSFLRSLR.A
  2.8        16         942        R.LGRPPAPKDK.W
  2.8        16         942        K.LLLHLQGER.E
  2.8        17         932        K.TPVQPRPRK.L
  2.7        17         919        R.GLPGPVGALGLK.G
  2.6        17         919        R.IPKALPSPQK.T
  2.3        19       -4.83        R.VAGVVAPTLPR.E
Top scoring peptide matches to query 949
Elution from: 35.57 to 39.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15256811.0 FinneganScanNumber: 2518
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.1       3.1      -18.46        R.LIRVIFYR.S
  7.9       5.1        19.0        K.DNPVPRLIR.L
  7.2         6        19.0        R.ARTPTLAPPR.H
  6.4       7.2        6.11        K.LLPAQLPAEK.E
  4.7        11      -14.72        M.RLISIAPGPR.W
  4.2        12        15.3        K.FLQFKLGAR.I
  3.0        16        19.0        K.GIKQDLIHR.L
  2.7        17       -4.34        R.VAGVVAPTLPR.E
  2.5        18      -11.16        R.IYAMKVVKK.E
  2.3        19      -14.74        R.GLPPLVATRR.E
Top scoring peptide matches to query 950
Elution from: 36.06 to 40.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15256811.0 FinneganScanNumber: 2601
Score greater than 25 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.5       1.8      -14.70        R.NNLVKHVKK.D
 12.0         2         946        MKVLEFLAK
 11.8       2.1        18.9        R.LFMILWLK.G
 11.5       2.2        19.0        K.DNPVPRLIR.L
  9.7       3.4        12.2        R.MKIFLRQK.K
  8.2       4.8        19.0        R.GLPGVAGRPGAK.G
  7.7       5.4        19.0        R.VSHTPRAAIK.A
  7.6       5.5        6.14        M.FLLKKSSEK.G
  6.7       6.7         946        R.VVKVMDFLK.T
  3.4        14       -4.27        R.IHKLEAQLK.D
Top scoring peptide matches to query 951
Elution from: 36.50 to 40.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15227395.5 FinneganScanNumber: 2677
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.6       3.4         943        K.LAGLHDAILR.M
  6.5       7.1         943        R.LQLHLGEIR.G
  6.3       7.4         943        K.ALQLLHDIR.E
  2.2        19         932        K.SPXHLSLIR.E
  2.1        20        19.0        K.DNPVPRLIR.L
  2.1        20         932        K.TPVQPRPRK.L
  1.8        21       -8.03        K.IGGIFAFKVK.D
  1.7        22      -14.69        K.GKRVIANPPK.A
  1.6        22         922        R.RGVGRALPPR.V
  1.3        23         919        R.LLLGPAGGGVPK.L
Top scoring peptide matches to query 952
Elution from: 20.80 to 24.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 309562.8 FinneganScanNumber: 1121
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.3       3.6         923        R.DASLMAMRR.R
 10.9         5         913        R.RSASSGSSSTR.S
 10.2       5.9         917        K.MPTTSTTSTR.F
  9.3       7.2         924        R.SSSNASSVSTR.L
  9.3       7.3         923        R.RMEMDKTR.E
  6.7        13         940        R.RTESEMSAR.I
  5.0        20         936        K.QQMEDFLR.K
  4.8        21         926        R.SPDSFSMRR.T
  4.6        22         910        R.ARSDDYLSR.A
  4.1        24         933        -.MELSGATMAR.G
Top scoring peptide matches to query 953
Elution from: 36.06 to 40.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6692006.2 FinneganScanNumber: 2600
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.2       2.3         922        K.IKGQPCPKR.L
 12.8         4        13.5        R.HKMSKAAPAK.K
 11.7       5.1         943        K.MKKSYTTPK.K
 11.6       5.3         939        K.YPYVAVMLK.V
  6.4        17         913        K.YATFKAAALK.A
  6.1        19        7.47        K.LAPLAQTEGGK.E
  6.0        19         940        K.AKSHQAGKEK.G
  5.1        23         933        -.MSAPPALQIR.E
  3.4        35         929        R.RPGGLGGSGGLR.L
  3.3        35       -9.71        K.HELGLMKLK.N
Top scoring peptide matches to query 954
Elution from: 35.61 to 39.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6692006.2 FinneganScanNumber: 2522
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.3        11         936        R.IFQPTPPGAR.K
  7.0        15      -13.25        R.EGALRAALQR.S
  7.0        15        16.6        K.FSHLPAKER.Q
  6.5        17       -0.59        R.LRFFSMKR.T
  6.1        19         929        K.GENNLRPRK.K
  5.3        22        16.6        R.ISHVPAASFR.A
  5.2        23         926        K.FGERPPPKR.L
  4.7        25         926        R.VHLVGQGAFR.A
  4.0        30        13.5        M.AAPALGLVCGR.C
  3.7        32        9.96        R.RAAPRPSSSR.V
Top scoring peptide matches to query 955
Elution from: 36.09 to 40.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6692006.2 FinneganScanNumber: 2604
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.5        11         913        R.QSLVAFYKK.K
  5.6        21         940        R.QVHRSESLK.N
  4.9        24        3.13        K.KGPNPLMRR.N
  2.1        46       -6.61        -.XIIVAEFHK.K
  1.9        49         926        R.IHAAQKPYR.C
  1.9        49         926        R.VHLVGQGAFR.A
  1.5        53        6.68        K.LYRKMMVK.A
  1.2        57         910        K.TTMTKVKFK.A
  1.2        57         916        R.VLSPSLPGASR.A
  1.2        58        13.5        R.GADGMKKHIK.E
Top scoring peptide matches to query 956
Elution from: 36.11 to 40.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6692006.2 FinneganScanNumber: 2611
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.2       2.9        9.76        R.LFPGHCILK.A
 10.6       6.6         919        R.RLPGAGGGRSR.F
  9.8       7.9         943        K.MKKSYTTPK.K
  9.2       9.1         936        LYTTAHHLK
  8.5        11       -6.61        K.LFLQHEGLK.Q
  8.1        12        13.5        R.HKMSKAAPAK.K
  7.7        13         943        R.IYKMNSSIK.L
  7.5        13        9.95        R.LQQQQRQR.E
  7.5        13       -2.87        K.LKKEAENPR.E
  7.5        13         940        K.AKSHQAGKEK.G
Top scoring peptide matches to query 957
Elution from: 20.95 to 24.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1386776.1 FinneganScanNumber: 1132
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.6        18        1.57        R.SRAEARQNR.H
  7.8        22      -11.28        R.GGKGSKGSQGPK.G
  7.6        23        11.9        R.LRGSGENGAAR.G
  7.5        23         925        R.TLNFLADHR.L
  7.4        24       -2.15        R.IQASYRGHR.S
  5.0        41         932        K.KCSSVKYSK.I
  4.9        42        15.4        K.VEGKAEPAMR.K
  4.9        42         908        K.SCWKKHIK.C
  4.3        49         922        R.KIHEERMK.L
  4.0        51        8.19        R.GWKGNELQR.C
Top scoring peptide matches to query 958
Elution from: 21.03 to 25.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1386776.1 FinneganScanNumber: 1140
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.7         7        9.44        R.QLEAQLEEK.N
  8.9        17      -12.06        M.HRLKCMVK.A
  8.3        19        15.4        K.VEGKAEPAMR.K
  8.3        19       -0.93        R.IDGKLDSPSR.S
  7.5        23      -11.28        R.GGKGSKGSQGPK.G
  6.8        27         939        K.DATQITQGPR.S
  6.7        28      -11.23        R.QREELREK.L
  5.9        33      -14.94        K.RYELLEHK.K
  5.7        35       -4.63        R.VVEEISHFK.T
  5.3        38      -18.09        K.KSVGVHSVMK.H
Top scoring peptide matches to query 959
Elution from: 23.54 to 27.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4650827.3 FinneganScanNumber: 1361
Score greater than 28 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.1       1.6        18.8        R.GPSPSYLGGPR.G
 14.4       4.7       -1.88        R.IQASYRGHR.S
 12.3       7.7      -11.00        K.NQSATLLGQR.S
 12.2       7.7        9.70        R.LESGEPAEKK.A
 11.8       8.6        15.7        NTPLRMDPK
 11.4       9.3         916        R.IQALEEDLR.E
  9.2        16       -4.37        R.SHSLPSSIIF.-
  8.3        19         933        R.LESLPPQMR.R
  7.3        24        8.45        R.ENYGVPPRR.A
  7.0        26       -4.37        R.VVEEISHFK.T
Top scoring peptide matches to query 960
Elution from: 23.98 to 27.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4650827.3 FinneganScanNumber: 1397
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.7        14      -18.41        K.TLYFFIAGR.Y
  9.6        14      -14.69        R.QPPGKEIYR.K
  8.3        19       -1.88        R.IQASYRGHR.S
  6.3        30        18.8        R.GPSPSYLGGPR.G
  5.5        36         939        K.SPGSSLPQGTR.S
  5.5        37       -0.66        K.AAADGVLSEVR.K
  5.3        38      -17.81        R.SPQMVSAIVR.T
  5.1        40         925        K.AVGTPAGGGFPR.R
  4.8        43         939        R.NTLPAVDNSR.C
  4.2        49         906        K.TGPSSLKSPGR.T
Top scoring peptide matches to query 961
Elution from: 35.65 to 39.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4100543.3 FinneganScanNumber: 2530
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.4       3.4       -3.39        K.AKQAKMAPSR.M
  6.0        37        0.94        R.NEKVKEVIE.-
  5.8        39         916        R.KHFEKLER.V
  5.7        40        3.41        K.SAASQKPRSR.G
  4.7        50         907        R.DSLVEALLAR.L
  4.5        53      -19.76        M.SVSVLSPSRR.L
  4.4        54        0.94        M.AQEIDLSALK.E
  3.6        64         931        K.DPVIGKSSQR.K
  2.8        79       -0.33        K.GRVTGWGNLK.E
  2.0        92         910        R.RRAKPSESR.H
Top scoring peptide matches to query 962
Elution from: 38.72 to 42.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 25508752.8 FinneganScanNumber: 2996
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.8       2.9        18.7        K.GALEAFAAALR.R
  8.1        17        15.6        K.QMLRQALLT.-
  6.0        27         908        K.MTLISPSVLK.K
  4.2        41         937        K.KLEGSIAASGR.G
  3.8        46         934        K.EALVPFSLGR.R
  2.7        58         931        -.MSQGPKTLVK.E
  2.5        61        15.6        -.KLLGPSSMTR.K
  1.3        80         920        K.KLVPSMGGRK.R
Top scoring peptide matches to query 963
Elution from: 37.78 to 41.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 164033439.1 FinneganScanNumber: 2892
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.3        16         938        R.GNAATLSLVSR.L
  2.4        63        16.1        K.ALSELRAMAK.A
  1.9        71      -14.21        R.KLYSIAAPAR.S
  1.4        78         931        -.MAPGEKIKAK.I
  1.4        78        5.78        K.TALRTKPMR.F
  1.4        79       -6.99        R.AMAVAKLLEK.R
  1.2        83         914        -.XKRLPAFNR.T
  1.1        84         934        R.MQRALRASR.S
  0.4        98         926        R.SFGRPRRGR.G
Top scoring peptide matches to query 964
Elution from: 35.84 to 39.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 164033439.1 FinneganScanNumber: 2564
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.8       5.7        5.90        R.INTLGRMIR.A
 10.0        11        16.2        R.EAMLKVINR.K
  5.5        30        5.91        R.QLEKLMRR.L
  4.4        40      -14.09        R.KLYSIAAPAR.S
  2.6        60        19.3        K.QLPQSTLFR.A
  2.2        66         905        R.GLNSLTKLSR.A
  1.9        69         938        R.GNAATLSLVSR.L
  0.8        90        16.2        K.TVLINNMLR.R
  0.7        93         921        K.EKIVKGVCR.I
  0.6        94        16.2        K.VAIMRNIEK.M
Top scoring peptide matches to query 965
Elution from: 35.69 to 39.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 164143508.0 FinneganScanNumber: 2539
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.9        22      -10.42        K.ISTISSVRAR.S
  4.0        43         931        -.MSQGPKTLVK.E
  3.2        52         938        R.NVLERSDKK.A
  1.6        76         934        R.ARSVLIADFP.-
  1.5        77        19.3        K.GALEAFAAALR.R
  1.4        79         908        K.INMLVIELK.S
  0.1   1.1e+02       -6.91        K.KTMVLGTPVK.I
Top scoring peptide matches to query 966
Elution from: 35.79 to 39.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 164033439.1 FinneganScanNumber: 2556
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       7.5      -14.09        R.KLYSIAAPAR.S
 11.1       8.5        5.91        R.QLEKLMRR.L
  8.5        15         914        R.AVRSSVWKR.E
  4.0        43        5.90        R.INTLGRMIR.A
  2.9        55         931        -.MAPGEKIKAK.I
  0.5        97      -10.43        K.VVKNTSGKTR.-
  0.1   1.1e+02       -0.10        K.VVERETKTK.A
Top scoring peptide matches to query 967
Elution from: 35.69 to 39.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 164143508.0 FinneganScanNumber: 2538
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.4        31       -6.91        K.KTMVLGTPVK.I
  4.8        36         931        K.LLGKLCEQK.Q
  4.1        42       -3.80        K.LGSFPSLAVAK.I
  0.6        94         921        K.KLVPSMGGRK.R
Top scoring peptide matches to query 968
Elution from: 37.78 to 41.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8180923.2 FinneganScanNumber: 2892
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 969
Elution from: 37.78 to 41.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8180923.2 FinneganScanNumber: 2896
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 970
Elution from: 35.79 to 39.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10597747.6 FinneganScanNumber: 2555
Score greater than 15 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.8        14        8.19        K.THTAVKIAPR.Y
  2.3        19        10.7        R.GRAGRRPAPR.Q
  0.4        29       -5.76        K.KRPHFPALK.K
  0.3        30        18.5        K.SKSLLVVPNH.-
Top scoring peptide matches to query 971
Elution from: 37.95 to 41.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 380375.6 FinneganScanNumber: 2921
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.1        11      -10.73        K.LALVNNTQPK.R
  7.8        11         898        R.EPVIKGAASPK.-
  5.9        18         898        K.NPQAVLDVLK.F
  5.4        20         927        -.MRLLGPHTR.L
  4.2        27         898        R.QIPEAANLIK.G
  3.8        29         917        M.AKPVYSLYR.Y
  2.2        42         898        -.XKHLLSELK.K
  1.3        52         921        R.GVPQQIEVAR.Q
  1.0        55         921        R.AHDAVLTLTR.H
  1.0        56         924        R.LMTSEFLKK.S
Top scoring peptide matches to query 972
Elution from: 20.80 to 24.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 283048.4 FinneganScanNumber: 1120
Score greater than 21 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9       3.3         923        K.AQNDVMEMK.M
  8.0       4.1         912        -.MPTVCGSSSR.R
  6.0       6.4       -8.30        R.HDSSDTSPPR.R
  1.4        18        7.88        K.KMDHDHDGK.L
  0.5        22       -7.86        M.ESISMMGSPK.S
  0.4        23        18.1        K.TEDYGMGPGR.S
  0.1        24      -12.15        R.MMQGMGKQR.N
  0.1        24      -12.15        R.MMQGMGKQR.N
  0.1        25      -12.14        K.CECAKMRK.V
  0.1        25       -1.91        K.CCEMLKNK.N
Top scoring peptide matches to query 973
Elution from: 20.80 to 24.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 283048.4 FinneganScanNumber: 1122
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.6       3.5       -9.08        K.CEACGKAFR.R
  7.5       4.5       -1.89        K.MAATMMASER.G
  7.0         5       -9.69        R.KHSSFCFW.-
  5.6         7         913        K.AENDMAMKR.A
  5.2       7.6         896        K.SEGSMSTDKR.E
  5.0       7.9         905        K.NHEEMNAPR.G
  5.0         8       -8.30        R.HDSSDTSPPR.R
  4.7       8.6         905        K.GNMGSEPPHR.I
  4.0        10        12.2        R.SSFSSDPDEK.A
  3.0        13       -9.11        CDVCGKGFR
Top scoring peptide matches to query 974
Elution from: 20.80 to 24.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 483134.0 FinneganScanNumber: 1120
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.5       4.6       -6.26        -.XKDSNSMVR.I
  6.7       5.6        7.05        MDQAEYQAK
  6.0       6.6         910        R.HDSSDTSPPR.R
  4.2        10         896        K.WDVHAAXER.K
  2.1        16       -6.69        R.RGEDDHTNR.Y
  1.4        19         927        K.KMDHDHDGK.L
  1.3        19         897        -.MWEKMETK.T
  0.8        22       -9.12        K.SSTYEELDR.V
  0.5        23         911        M.ESISMMGSPK.S
  0.2        25       -3.16        K.EYREAMER.M
Top scoring peptide matches to query 975
Elution from: 18.23 to 22.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 836383.8 FinneganScanNumber: 943
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 32.7     0.049       -0.90    1   IPI00301263 K.GEVRPELGSR.Q
 17.2       1.7      -11.13                    R.VEGGVRGAAQR.A
 16.6         2        19.6                    R.SSSGLSSFSLK.I
 14.8         3      -13.58                    K.SSGISLPPVDK.K
 13.0       4.5         919                    R.EGVRRGGPDR.E
 12.1       5.5       -0.88                    R.EAQAGAAPKTR.Q
 11.2       6.8         919                    R.ARRGEAEGPR.A
 11.0       7.1      -11.10                    R.AQEQSPRKR.G
 10.9       7.3        11.8                    R.GERRGPQGSR.E
 10.7       7.6        8.12                    R.AQWAGPRASR.E
Top scoring peptide matches to query 976
Elution from: 18.18 to 22.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 836383.8 FinneganScanNumber: 940
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 21.9      0.58         899                    K.KFTVTVTMR.T
 18.5       1.3         896                    R.NSSGLTVHKR.I
 16.4       2.1      -11.12                    R.ARSQTNPGLR.A
 15.9       2.3       -0.90    1   IPI00301263 K.GEVRPELGSR.Q
 14.2       3.4        9.34                    R.ALASVGPEEAR.S
 13.3       4.2         896                    R.GSRQPDGLLR.K
 13.0       4.5      -17.84                    K.LIRMGPQER.W
 12.1       5.5         919                    R.ARRGEAEGPR.A
 11.9       5.8         931                    K.WEMARHLR.E
 11.8       5.9      -14.78                    R.GAAWGSLRPGK.R
Top scoring peptide matches to query 977
Elution from: 36.12 to 40.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 605227.4 FinneganScanNumber: 2613
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        25       -7.82        K.NGMPGVGLLAR.H
  2.3        65         898        R.MSFSSLKRK.Q
  1.1        85       -1.09        R.GGKTPSGAAAQR.A
  1.1        86         925        R.LLAASDPPASAS.-
  0.0   1.1e+02         898        K.MLANHLLGSK.S
Top scoring peptide matches to query 978
Elution from: 36.47 to 40.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1327525.0 FinneganScanNumber: 2672
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 979
Elution from: 36.50 to 40.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1327525.0 FinneganScanNumber: 2679
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 980
Elution from: 20.97 to 24.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 438185.5 FinneganScanNumber: 1133
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.3        11         890        R.HGGSLVNHRK.I
  6.5        33        18.7        K.LSATWGISDR.D
  5.8        39         916        M.EAWRCVRK.G
  5.4        42        15.7        -.XNLMAIVSDR.K
  5.0        47        18.7        M.VTWEGTGSIR.K
  4.7        50      -14.20        K.NSLTKTQWK.T
  4.7        50        15.7        M.SGALDVLQMR.E
  4.6        51        5.51        R.LLATGGMDRR.V
  4.6        51        15.7        K.EPTEKKMAR.A
  4.5        52         928        -.MSLPSTPDIK.I
Top scoring peptide matches to query 981
Elution from: 35.75 to 39.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 46606529.5 FinneganScanNumber: 2550
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.1       5.8         908        R.ALAPLRDPPR.R
  8.0       9.4        14.1        M.SQTKMLKVR.V
  7.8       9.8         895        K.LGLPPPLDGVK.R
  6.4        14         904        R.KIKFWDLR.R
  6.3        14         894        M.KSRWIFIR.T
  5.5        17         918        R.VLRVFTQKD.-
  3.7        25        17.1        K.NFQVTLTKR.R
  1.3        44         918        R.FLVTVVTGNR.T
  0.9        48         899        K.TSKTTSKKPK.K
  0.9        48         910        R.GRRRPNPPR.K
Top scoring peptide matches to query 982
Elution from: 35.79 to 39.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 46606529.5 FinneganScanNumber: 2558
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.7       7.5         925        R.ELTINIKMK.E
  8.3       8.2         918        M.ALSQGLLTFR.D
  8.0       8.7       -5.53        K.KKSNLELFK.E
  6.0        14         906        K.VEVYLLELK.L
  5.5        16         918        K.KQVEYAVLR.N
  5.2        17         908        M.RPLPPVGDVR.L
  3.0        28         895        K.IVNAVVSYIK.G
  2.7        30        4.62        K.ILDTFEKLK.D
  2.6        30        17.2        R.RVELFSLSR.Q
  2.6        30         915        K.IIPPLFSYR.L
Top scoring peptide matches to query 983
Elution from: 35.86 to 39.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 46606529.5 FinneganScanNumber: 2567
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       3.4        4.64        K.LIETDFKIK.F
 11.7       3.7        3.85        K.KVPMMLIFK.R
 11.7       3.7         904        R.RPPPPPFVAK.H
 11.1       4.3        4.65        R.IKFESLEIK.L
  9.9       5.6      -15.68        K.QFLRISKSK.D
  9.8       5.8       -5.51        K.FKLNKSELK.E
  7.5       9.7        17.2        R.RDGKQYVIK.K
  7.5       9.7        4.64        K.ILDTFEKLK.D
  7.1        11        4.67        R.EYAIKILEK.R
  7.0        11       -5.53        K.GTAKVDFLKK.I
Top scoring peptide matches to query 984
Elution from: 35.95 to 39.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 46606529.5 FinneganScanNumber: 2582
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8       7.3       -5.46        R.LYLSKNQLK.E
  6.5        12         906        K.ELEVYLLVK.N
  6.5        12         918        K.QGERYILVK.K
  5.5        16       -5.46        K.FKLNKSELK.E
  5.5        16        4.70        R.IKFESLEIK.L
  5.2        16       -3.04        R.GHRPLDKKR.E
  3.5        25        3.47        K.IIGAGKPWHK.N
  3.0        28        17.3        K.GYGKRVADIK.E
  1.7        37       -5.47        R.YSLAVGLQKK.D
  1.6        38        17.3        R.YQLAVTQRK.E
Top scoring peptide matches to query 985
Elution from: 38.79 to 42.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5579560.6 FinneganScanNumber: 3000
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.3         4       -4.21        K.LGTKGIIPNPP.-
  7.1        11         927        R.ELTINIKMK.E
  6.5        12         916        K.IIPPLFSYR.L
  5.9        14         899        K.GPLLRHVASR.H
  5.9        14         920        K.VVSPKYLGSR.T
  4.5        19         913        K.TIQMPFLKK.H
  3.8        22         920        R.DQVSFLIRK.E
  3.2        26         909        R.KITSRPFTR.F
  2.9        28         916        R.VMTLKTSIRG.-
  1.3        40         927        K.KLTEVKMEK.D
Top scoring peptide matches to query 986
Elution from: 38.83 to 42.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4869366.0 FinneganScanNumber: 3004
Score greater than 21 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8       5.6        18.6        K.KRPTSAVGYK.R
  7.5       9.6       -4.17        K.KKSNLELFK.E
  7.3        10      -14.36        K.KVGGIVSKYR.T
  6.5        12        18.6        R.FVSIDNKKR.N
  6.5        12        17.4        R.APAPRWPRR.R
  6.1        13        5.18        K.KVPMMLIFK.R
  1.9        35       -4.20        R.ETLTRVLFK.Y
  1.9        35         920        K.LKYVLQDAR.F
  1.9        35       -4.20        K.LGTKGIIPNPP.-
  1.8        36         920        R.ILINDAYKR.T
Top scoring peptide matches to query 987
Elution from: 37.87 to 41.88 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 46606529.5 FinneganScanNumber: 2912
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.9       8.8      -14.29        R.RLKFNSTIK.V
  7.6       9.3         920        R.FLVTVVTGNR.T
  7.6       9.4      -14.29        K.QFLRISKSK.D
  7.6       9.4         920        K.YVAKVVAEAR.I
  7.2        10      -14.31        K.KVGGIVSKYR.T
  6.2        13         920        R.ILINDAYKR.T
  6.1        13        8.43        R.QVVRSSKFR.H
  4.9        18         920        K.QYVLTALAAR.A
  3.7        23         920        R.NLVSLGLSFR.R
  3.7        23         909        R.LVFREGRTK.A
Top scoring peptide matches to query 988
Elution from: 20.32 to 24.32 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 834937.0 FinneganScanNumber: 1076
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 48.9    0.0013       -0.67   11+  IPI00293665 AQYEEIAQR
 20.4      0.94       -3.73                    M.ATVMAATAAER.A
 19.8       1.1         912                    R.GSWRETGTGR.A
 18.6       1.4       -0.67                    K.AEFQEEAKR.R
 18.4       1.5         897                    K.METEAELRK.S
 17.9       1.7         908                    K.SSLSWWGQR.W
 17.7       1.8         919                    K.XEMQSAGSQR.G
 17.7       1.8         919                    K.XEMQSAGSQR.G
 17.2         2         903                    K.SSKEDGEARK.G
 15.3       3.1        2.17                    -.MARSMLGGER.S
Top scoring peptide matches to query 989
Elution from: 20.32 to 24.30 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 834937.0 FinneganScanNumber: 1075
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 39.0     0.013       -0.67   11+  IPI00293665 AQYEEIAQR
 24.9      0.34       -0.67                    K.AEFQEEAKR.R
 17.9       1.7        2.17                    K.MRASMDPKR.F
 14.3       3.8       -3.72                    K.AEEMLSKQR.H
 11.6       7.1        2.17                    R.CREVMEKR.E
 11.4       7.5         892                    -.XAAMATARVR.M
 11.0       8.3        15.4                    K.EAGMFAPTQR.T
 10.7       8.9       -3.75                    -.MDKQSSAGGVK.R
 10.3       9.6       -3.73                    K.QKAELMTDR.V
  9.5        12         919                    K.XEMQSAGSQR.G
Top scoring peptide matches to query 990
Elution from: 35.99 to 39.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4064928.8 FinneganScanNumber: 2591
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.6       4.6         908        K.IFSLMKEAR.K
 11.2       6.4         901        R.FNDIHVPIR.L
 10.7       7.1         901        K.SWQPQVPLR.I
 10.7       7.2         892        K.SSSHLPLIEK.S
  9.8       8.8       -2.14        R.IRTSEGRHR.A
  9.1        10      -14.67        K.RLEDNLPVR.E
  8.8        11       -4.58        R.QTPSPDVVLR.G
  8.8        11         919        R.QLEAPLPPMV.-
  7.7        14         915        K.AFSQSSSLRK.H
  7.6        15         908        K.IFSKMDKNK.D
Top scoring peptide matches to query 991
Elution from: 36.01 to 40.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4064928.8 FinneganScanNumber: 2594
Score greater than 21 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.0        10         905        R.SAQHSQALLR.G
  8.7        11       -5.31        R.MAMFKKSLR.I
  7.5        15        13.9        -.MRGAGGPRGPR.G
  7.4        15         915        R.TPPEPSAKQR.S
  5.9        21         898        R.VAPKPPQMSR.A
  5.7        23         915        R.DTVQLPPGGAR.G
  5.7        23        1.33        K.LMGQIHQLR.S
  5.6        23        18.1        K.ASGAPPAGLGSAR.E
  5.6        23      -14.67        K.GINSTTIHLR.W
  5.5        24         911        R.LFTPISGGYR.T
Top scoring peptide matches to query 992
Elution from: 18.90 to 22.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1724044.4 FinneganScanNumber: 985
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 92.8   2.3e-08       -0.53    1   IPI00301263 R.TSSSFAAAMAR.L
 15.0       1.4         883                    K.AAPQPDMSAAR.Y
 13.8       1.8       -7.15                    K.VYSLEMMAR.Q
 13.6       1.9         912                    K.VMDWYQTR.A
  8.6       6.1        6.10                    R.TSAGHEEGATR.L
  8.3       6.4         896                    K.VVQYDGYDR.F
  8.3       6.5      -11.20                    R.AFGTSAGWYR.A
  7.4         8        8.33                    R.GPGSFPXNMR.E
  7.1       8.6       -0.53                    R.TSSMPEQAHK.V
  6.4        10      -16.46                    R.EDSAPPSSVAR.S
Top scoring peptide matches to query 993
Elution from: 18.79 to 22.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1724044.4 FinneganScanNumber: 976
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 71.7   2.9e-06       -0.53    1   IPI00301263 R.TSSSFAAAMAR.L
 16.4         1         912                    K.VMDWYQTR.A
 10.4         4       -7.62                    K.GWDGVHTSTR.E
  9.5       4.9        8.33                    R.GPGSFPXNMR.E
  8.8       5.9      -11.20                    R.AFGTSAGWYR.A
  8.8       5.9        6.10                    R.TSAGHEEGATR.L
  8.6       6.1       -7.15                    K.VYSLEMMAR.Q
  8.5       6.2         916                    K.DASSCYRQK.K
  7.9       7.2         883                    K.AAPQPDMSAAR.Y
  6.0        11        9.55                    -.MAEYDLTTR.I
Top scoring peptide matches to query 994
Elution from: 18.83 to 22.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1724044.4 FinneganScanNumber: 979
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 77.2   8.5e-07       -0.53    1   IPI00301263 R.TSSSFAAAMAR.L
 14.8       1.5       -7.62                    K.GWDGVHTSTR.E
 14.3       1.6         883                    K.AAPQPDMSAAR.Y
 12.7       2.4      -16.46                    R.EDSAPPSSVAR.S
 12.3       2.6         916                    R.XGCAPDLGGPR.A
 11.0       3.5      -11.20                    R.AFGTSAGWYR.A
 11.0       3.5       -7.15                    K.VYSLEMMAR.Q
 10.0       4.4        6.10                    R.TSAGHEEGATR.L
  8.3       6.5        9.55                    -.XYLTMDETR.K
  8.3       6.5         912                    K.VMDWYQTR.A
Top scoring peptide matches to query 995
Elution from: 26.27 to 30.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 523275.4 FinneganScanNumber: 1637
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.4       5.6         892        K.RNSIAGFPPR.V
  9.6        13         906        R.RLNDAAIEGR.L
  9.4        14         906        R.AAQELSRSPR.L
  9.2        15         896        R.TTSGPRRSPR.R
  9.0        15         883        M.SIAGVAAQEIR.V
  8.6        17       -0.32        R.TQEPSLGKQK.V
  8.5        17         916        K.DIEGLLGAGGGR.N
  8.5        17       -0.32        R.DSGPAIGKDKK.T
  8.4        18         906        K.AERSPNQGKK.G
  8.3        18         912        R.TVAGYGKFSGK.M
Top scoring peptide matches to query 996
Elution from: 37.65 to 41.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5603211.1 FinneganScanNumber: 2871
Score greater than 19 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.4        20         902        K.IEEISPSTLK.N
  5.9        35         882        K.DSQIKSIIGR.L
  3.6        59         908        -.MNVQVGDIIK.L
  1.9        87        9.81        R.ASLEATIADVK.Q
  1.0   1.1e+02       -0.26        K.ALGVSLNATSGK.S
  0.4   1.2e+02        5.59        R.LCDRLQKGK.A
  0.1   1.3e+02         908        -.MLDVLQELR.G
Top scoring peptide matches to query 997
Elution from: 37.88 to 41.88 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5603211.1 FinneganScanNumber: 2915
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.9        22       -0.26        K.ALGVSLNATSGK.S
  6.6        30         914        R.KAGVQELESR.V
  4.5        49        1.98        R.WDIMAVRVK.A
  3.4        62         894        R.TDVRARGVSR.V
  3.2        65         898        -.MKAVPTVAGAR.F
  2.9        69         897        K.QLLHSPFFK.V
  2.7        72         892        KNISVAEVEK
  2.3        80         901        R.TPKVNPFSAR.Q
  1.6        95      -13.90        K.THLKKAEYK.K
  1.4        97      -16.92        K.KLLMQLEAR.E
Top scoring peptide matches to query 998
Elution from: 37.92 to 41.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5603211.1 FinneganScanNumber: 2920
Score greater than 22 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8        14         898        R.QQIAMSAIVR.S
  9.2        16        9.02        R.TPMVSVPKMK.H
  8.5        19         914        -.XTAGPVTGSASR.G
  8.5        19         914        -.XTAGPVTGSASR.G
  6.5        31        8.61        R.YGSGLLSHKR.V
  6.1        33       -6.85        R.LEKIMENLK.N
  5.7        37         882        K.ERLTIELSR.T
  5.5        38         914        R.KAGVQELESR.V
  5.0        43         892        K.VSIAIEEVTR.C
  4.9        44         892        KNISVAEVEK
Top scoring peptide matches to query 999
Elution from: 37.45 to 41.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5603211.1 FinneganScanNumber: 2838
Score greater than 18 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.3        32      -16.93        R.LTNLVIAMAR.K
  5.5        38         900        R.GHLPRFHPR.T
  3.1        66       -6.86        K.IIEMGNLSLK.Q
  2.8        72         914        -.XTAGPVTGSASR.G
  2.8        72         914        -.XTAGPVTGSASR.G
  2.1        83         914        K.LATLSDQVNR.R
  1.7        92       -1.45        R.IFPEGSRRR.K
  0.8   1.1e+02         903        R.GHLVHGQRGR.L
  0.7   1.2e+02        18.7        K.GYEAPQIALR.C
  0.2   1.3e+02      -16.91        K.SRLMGLEALK.S
Top scoring peptide matches to query 1000
Elution from: 37.45 to 41.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5603211.1 FinneganScanNumber: 2840
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8        22         882        K.TTLEVLRER.S
  7.6        24       -1.44        R.IFPEGSRRR.K
  6.6        30       -0.25        K.TPQSQKTSLK.N
  5.5        38      -13.91        R.NSLNPFKGLK.E
  5.5        39         914        K.RCLLPLCGK.F
  5.2        41         904        R.TQEAKDIRR.A
  5.2        41         882        K.LDSNLTRAVK.E
  5.2        41       -0.24        K.TIETVKAAER.I
  5.0        43         882        R.QVTESKGVLR.H
  5.0        43         904        K.SSGPTGLVRSR.T
Top scoring peptide matches to query 1001
Elution from: 37.99 to 41.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2838069.1 FinneganScanNumber: 2928
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.8        18         909        K.QLQEVKFVK.D
Top scoring peptide matches to query 1002
Elution from: 37.92 to 41.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2925147.3 FinneganScanNumber: 2920
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.3        11         909        R.TYKEPKKPK.A
  3.6        20         902        R.TLSRRSTGXK.S
  3.6        20         902        R.TLSRRSTGXK.S
  1.9        29      -14.16        K.LIPGPLSPVAR.G
Top scoring peptide matches to query 1003
Elution from: 38.02 to 42.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2838069.1 FinneganScanNumber: 2935
Score greater than 15 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.5        25      -14.17        K.GFIKVTLSVR.A
Top scoring peptide matches to query 1004
Elution from: 21.49 to 25.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1106704.5 FinneganScanNumber: 1174
Score greater than 31 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.4      0.82         889        K.NSTEWEKVK.S
 17.1       2.2        12.4        R.MREAVQEMK.D
 16.5       2.5        15.4        K.MYEEHLKR.M
 16.0       2.8         886        R.DEIEAMIKR.V
 15.9       2.9        19.0        -.MREKEQER.E
 15.6       3.1         885        K.VISMGNAEVGK.S
 14.2       4.3        19.0        R.RVSEAEMAGR.E
 13.8       4.7         889        K.GYAPESVLER.S
 13.4       5.2         915        K.RSGNSDSIER.D
 13.2       5.4         894        K.DIWSMANRK.V
Top scoring peptide matches to query 1005
Elution from: 21.56 to 25.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1122158.9 FinneganScanNumber: 1183
Score greater than 30 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.5       1.6        12.4        R.MREAVQEMK.D
 16.8       2.3         889        K.NSTEWEKVK.S
 14.8       3.7         885        K.MGVLEEGGKGK.E
 13.7       4.8         885        -.MVAPSSIAGSGK.Q
 12.8       5.9         892        R.VKDAQGGGSSSK.K
 12.7       6.1         878        R.GFVQVDDGRK.I
 12.6       6.2         894        K.DIWSMANRK.V
 12.3       6.7         913        K.VFCQPWQR.C
 11.5         8        12.3        K.DCVIVTCVR.A
 10.8       9.4         888        R.DDQQVFIQK.V
Top scoring peptide matches to query 1006
Elution from: 27.94 to 31.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 387746.8 FinneganScanNumber: 1793
Score greater than 15 indicates homology
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.4       3.2         893        R.KLVLEIIHR.I
  2.2       3.3        16.8        R.RVVKGRPGPR.K
Top scoring peptide matches to query 1007
Elution from: 35.84 to 39.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15542773.7 FinneganScanNumber: 2563
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.7       3.7         905        K.VQATGPPALLR.G
  6.7         6        7.53        K.NKLSHIKQR.I
  6.3       6.5      -14.89        R.RSLVISPPVR.T
  1.5        20         882        R.LLLSGPPQIGK.T
  1.2        21         885        R.LRAPSGPIRR.Q
  1.2        21         895        R.GGRILLGHATK.S
  0.9        22        7.52        R.IQQIPNVRR.R
  0.8        23       -4.88        R.NLALDLVLPR.G
  0.3        26        17.5        R.HLAEELRKK.E
  0.3        26        7.53        K.SHLNQLKKR.R
Top scoring peptide matches to query 1008
Elution from: 35.90 to 39.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15542773.7 FinneganScanNumber: 2574
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8       3.7      -14.86        R.ALDLLRGLPR.V
  7.0       5.5        7.54        R.APQTRAVKPR.L
  6.5       6.2       -2.46        R.APGAGGRLRLR.G
  6.1       6.9        7.54        K.VIHRDLKSR.N
  3.1        13       -2.46        R.RRLQVGPAAR.G
  2.6        15        7.53        R.VLARIHTGTR.T
  2.5        16       -2.46        R.RLGPGGAARLR.V
  2.5        16      -14.86        R.DRLPILLQR.R
  2.4        16      -14.87        R.HSGLVLKTIR.V
  0.3        26         904        R.AWRRPRPAL.-
Top scoring peptide matches to query 1009
Elution from: 35.93 to 39.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15542773.7 FinneganScanNumber: 2580
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4         5        19.9        R.GRRPARPGTR.L
  1.4        20         882        K.KLLEALSHLV.-
  0.8        23      -14.87        K.VPQRVTAKPK.T
  0.6        24         879        M.FIVALFTIAK.T
  0.2        26        14.0        R.RLVLFYQGK.L
Top scoring peptide matches to query 1010
Elution from: 36.56 to 40.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 15542773.7 FinneganScanNumber: 2685
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.1       2.1        14.0        FRTPSFLKK
  3.8        12         912        R.SAILTSMKKK.L
  0.9        23        7.58        R.QHLLSLTRR.A
  0.9        23        14.0        M.AITQFRLFK.F
  0.5        25        0.99        K.LIMGIGHRVK.S
  0.5        25        7.58        R.LQRVGKHASK.F
  0.4        25       -2.42        R.RRLQVGPAAR.G
Top scoring peptide matches to query 1011
Elution from: 23.65 to 27.64 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 790761.2 FinneganScanNumber: 1367
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.2        20         891        MISTTSKETK
  6.6        22         874        K.SPGIPEGANRK.K
  6.6        23         892        K.AGPAGAWPVGSR.T
  5.7        27       -5.01        R.QVYGLNFASK.E
  5.7        27         899        K.FNPVSFTWK.K
  3.8        43         908        -.MAHPERAWK.L
  3.5        46      -12.60        R.QAPPGRAHHR.R
  2.8        54         912        K.ICMQWFIK.V
  2.8        54         912        K.MSRASDRFR.G
  2.8        54        14.3        -.MGPAPAGEQLR.G
Top scoring peptide matches to query 1012
Elution from: 28.01 to 32.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 413822.8 FinneganScanNumber: 1798
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 67.0     2e-05       -0.50    8   IPI00024067 K.VANVELYYR.A
 17.5       1.8        13.0                    R.ELDSGLEVHK.I
 13.9         4        13.0                    R.VKGDPEDAAPK.D
 11.1       7.7        8.85                    K.SPCPSPGIRR.G
 10.4       8.9      -16.89                    K.RKASSHAVDR.L
  9.6        11      -10.49                    K.WVAAEGPGLAR.A
  8.7        13       -1.12                    R.VLRSQCAHR.E
  8.3        15         888                    K.GPEVDIRDPK.V
  8.0        16       -6.91                    K.GRDSPISAPAR.D
  7.4        18        15.4                    K.GRGLQESSHR.E
Top scoring peptide matches to query 1013
Elution from: 28.13 to 32.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 413822.8 FinneganScanNumber: 1806
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 45.0    0.0031       -0.50    8   IPI00024067 K.VANVELYYR.A
 19.0       1.2         904                    R.ISAEGPAPMPR.R
 14.8       3.3         888                    R.VALSEPQPER.R
 13.4       4.5       -6.91                    K.GRDSPISAPAR.D
 12.6       5.4        13.0                    R.LGLAGAQPSSPE.-
 12.5       5.5        13.0                    R.ELDSGLEVHK.I
 10.1       9.7      -10.49                    R.AVLSAFHEPR.Y
  8.7        13        15.4                    K.GRGLQESSHR.E
  8.6        14         904                    K.ILREMYER.Q
  8.6        14        13.0                    K.GDIPPLTDNGK.G
Top scoring peptide matches to query 1014
Elution from: 17.40 to 21.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 287651.0 FinneganScanNumber: 893
Score greater than 28 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 30.3     0.064        0.02                    K.KDVDAAYMSK.V
 30.1     0.068        0.01    7   IPI00220327 K.KDVDGAYMTK.V
 13.9       2.8        5.36                    R.WGGAQGGGGGAPR.W
 10.0       6.9        0.02                    K.ENVQLMSYK.V
  9.6       7.6       -6.95                    -.XDYARFEAK.I
  9.0       8.6         884                    R.QETVDYMIK.Q
  8.8         9        15.4                    R.EDWDAHKAR.C
  8.4       9.9         881                    K.NEAGEAHASIK.V
  7.8        11        8.80                    R.IMDPHYSHK.G
  7.2        13         893                    K.SRDQEAGAHR.T
Top scoring peptide matches to query 1015
Elution from: 23.67 to 27.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 437412.8 FinneganScanNumber: 1371
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8        12         906        K.IITVMSMGMK.C
  7.5        16         905        -.MGPAPAGEQLR.G
  7.5        16         906        K.IITVMSMGMK.C
  6.0        23         909        K.TSTDFSEVIK.Q
  5.7        24         876        R.LLFSEMKMK.V
  3.5        41         873        R.NAMLVVPPGGR.A
  2.8        47        1.09        -.MRGAGGPRGPR.G
  2.5        50         886        R.HVPEEYKPK.Q
  2.4        51        5.28        M.AAHGGSAASSALK.G
  2.3        53        7.49        -.MAGAPHLQFR.L
Top scoring peptide matches to query 1016
Elution from: 35.93 to 39.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7276729.5 FinneganScanNumber: 2576
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.1        16         892        K.ASRTKSPGPAR.R
  7.5        18         878        R.RFRPGELPR.V
  7.2        19         892        R.NLSRAAPDKR.S
  7.1        20        2.67        R.YTYLEKAIK.I
  6.3        24       -3.77        R.DVRLVDAGGVK.L
  4.0        41        8.59        R.TGLGGNGRLAGR.L
  3.3        47         902        M.RIPVDPSTSR.R
  3.3        48        18.6        R.EPLGSVSAGRR.A
  3.1        50         875        R.KAMLPARGQR.A
  2.8        53         885        K.KNLPAGGAMIR.C
Top scoring peptide matches to query 1017
Elution from: 35.93 to 39.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7276729.5 FinneganScanNumber: 2581
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       7.1         885        K.RAPLLLECR.H
  8.2        15         898        K.LLXPPPGNYR.L
  7.6        18         898        R.QPSYVPAPLR.K
  7.4        19         878        R.RFRPGELPR.V
  6.6        22         880        R.QVKPNATLEK.H
  6.3        24         882        K.LLCFRYKK.L
  5.6        28         898        R.GASLGPPPYLR.T
  5.0        33         882        R.RGAASLPRGSR.R
  3.1        50         885        K.KNLPAGGAMIR.C
  3.0        51         898        M.HTAVTIPGGFK.I
Top scoring peptide matches to query 1018
Elution from: 36.40 to 40.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7216595.9 FinneganScanNumber: 2660
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.4       4.6      -13.69        R.KLQKQEQAR.V
 13.2       4.9         880        K.KIDLSHVTSK.C
  8.8        14         876        R.WVDLEKPLK.K
  8.8        14         882        R.GGRGRPTLASR.F
  7.3        19      -13.71        K.LGVSVSPSRAR.R
  6.9        21         885        -.MPVRGAAVQAK.I
  6.5        23       -4.93        K.RTWVSPRAR.N
  6.4        23      -13.71        K.TKPSQKVQGR.G
  5.9        26        8.62        R.ARAAAAQSVQR.Q
  5.8        27        8.62        R.NDRREGLIR.S
Top scoring peptide matches to query 1019
Elution from: 28.91 to 32.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1929089.0 FinneganScanNumber: 1863
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 39.0     0.016       -0.84    2+  IPI00011654 R.FPGQLNADLR.K
 25.8      0.34        2.75                    K.ENKGEERLR.S
 20.7       1.1        12.7                    R.LEEGEERLR.R
 17.7       2.2         870                    -.MRSGGRGRPR.L
 16.4         3         881                    K.EDAIWNLLR.Q
 13.2       6.2         885                    R.QDEALRELR.H
 12.8       6.8         895                    R.LEEAEQAALR.G
 11.8       8.6       -3.84                    R.KCVTTPPTAR.T
 11.8       8.7         878                    K.DPVXEIKIR.X
 11.7       8.8        12.7                    R.NLSLDVEANR.Q
Top scoring peptide matches to query 1020
Elution from: 28.91 to 32.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1929089.0 FinneganScanNumber: 1861
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 35.3     0.039       -0.84    2+  IPI00011654 R.FPGQLNADLR.K
 20.2       1.3         891                    K.AESLADLWPK.S
 17.3       2.4         878                    R.KICANDAIPK.T
 17.3       2.4         888                    K.LNDMIDAIPK.S
 16.1       3.2         875                    R.SRSRSQSPPK.D
 15.8       3.4         895                    R.LDQAALDDLR.T
 14.2         5        2.75                    K.ENKGEERLR.S
 12.9       6.6         885                    K.NKQQGDKSPK.N
 11.5       9.3         885                    R.QDEALRELR.H
 10.1        13        12.7                    R.NLSLDVEANR.Q
Top scoring peptide matches to query 1021
Elution from: 36.75 to 40.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 784020.1 FinneganScanNumber: 2718
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1022
Elution from: 35.99 to 39.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3654964.8 FinneganScanNumber: 2588
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.8       5.5         871        R.ILDELTLCR.S
 13.1       6.4      -12.01        R.LHALLMPPEP.-
 11.1        10      -18.96        K.WTSLPNFLR.S
 10.8        11       -5.49        R.LDDQIFLNR.N
 10.7        11         893        R.CQQIDVKNK.L
  9.9        13         878        M.LGTSVAPASSSR.C
  9.3        15         871        K.IPASMKEVNK.A
  9.0        17         893        R.ITCIQVENR.Y
  8.9        17         877        K.ERMILPMSR.A
  8.7        18        6.78        R.LPHSGGPAAGGGR.Q
Top scoring peptide matches to query 1023
Elution from: 36.28 to 40.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 166697171.8 FinneganScanNumber: 2637
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8        12         900        M.FPGSLSRGRR.A
  8.3        13         885        K.LKMQAEIKR.I
  4.4        32         900        R.RRGTWSTLR.Y
  4.1        35         878        R.SSTLRWVKR.R
  3.5        40        8.42        M.SLKSATKWGR.R
  2.2        53       -3.87        K.SSLFLAPSALK.L
  1.4        65         885        K.KIQLAKEMR.S
  1.3        66         895        R.MLEEILKTR.F
  1.1        69         875        R.SKRMVVIQR.C
Top scoring peptide matches to query 1024
Elution from: 36.02 to 40.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 166697171.8 FinneganScanNumber: 2596
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 13.2       4.3        8.42                    K.RYAVIGADLR.D
 10.4       8.2        5.44                    K.SSRILTGMLR.R
 10.0       8.9        18.3                    K.LDDFIKNLR.G
  9.3        10      -16.77    5   IPI00644620 -.MGTLLISKVR.E
  8.8        12         891                    R.EGTSRSLKVR.T
  8.4        13      -13.78                    K.APPLLEGAPLR.L
  8.2        14         897                    K.RGLFWANIR.A
  8.2        14         897                    K.RGLFWANLR.A
  5.7        24        15.4                    K.VEMKEKTLR.A
  5.6        25        1.91                    K.LAAKAYMPLR.A
Top scoring peptide matches to query 1025
Elution from: 36.12 to 40.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 166635676.9 FinneganScanNumber: 2614
Score greater than 14 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.1        43         885        K.KDMLAALKSR.Q
  1.4        65         875        R.SRKICISLR.S
  0.6        77         869        K.IKKLTGSTER.Y
Top scoring peptide matches to query 1026
Elution from: 36.11 to 40.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 166635676.9 FinneganScanNumber: 2610
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.0        22         888        M.IERGELFLR.R
  5.6        24         901        R.LLSGSKEKDR.S
  3.8        37         895        K.ELTMIVTGIR.L
  3.0        45         898        R.LDVSLPFVSR.G
  2.9        46         885        R.LISLMLRDR.W
  2.4        51         888        R.KAAALEFLNR.F
  1.6        61         868        K.LMIMLRSIR.E
  1.2        67        18.3        R.IFSGGLSPSLR.R
  0.7        75        15.4        R.IKESLKMER.D
Top scoring peptide matches to query 1027
Elution from: 39.14 to 43.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19721245.4 FinneganScanNumber: 3025
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.3        21         898        K.IIEKVDYPR.D
  4.6        31         888        R.NILVLGNSFR.R
  4.0        36         878        R.SRPVVPPAGPR.T
  3.5        40        8.41        K.VDIPSPPPRR.C
  2.0        55         900        M.FPGSLSRGRR.A
  1.3        66         871        -.MLRLPTVFR.Q
  0.6        78         881        -.MVPLKIEFR.R
Top scoring peptide matches to query 1028
Elution from: 39.14 to 43.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 19721245.4 FinneganScanNumber: 3026
Score greater than 15 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.7        19      -10.24        K.TIGSSASVKRK.E
  2.0        56         891        R.TTEGRLTKAR.N
Top scoring peptide matches to query 1029
Elution from: 37.95 to 41.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 166697171.8 FinneganScanNumber: 2925
Score greater than 21 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9        11         898        R.TVFTHLSSLK.R
  8.0        14       -3.73        R.GILQTLNVYL.-
  5.8        23         878        R.KRGEPPPPVR.R
  5.0        28         885        K.KDMLAALKSR.Q
  4.1        34         900        R.SGGRLSRFPR.F
  3.9        36         888        R.GQPVSLHLPGK.G
  3.5        40        17.3        R.LHRGFRGYK.T
  3.4        40        8.55        K.VVQLLPDGHR.V
  3.4        41        18.5        -.LSALLQDAFR.A
  2.0        56         894        K.QVVIIHHMR.L
Top scoring peptide matches to query 1030
Elution from: 37.74 to 41.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 166697171.8 FinneganScanNumber: 2888
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.7        20         886        K.KDMLAALKSR.Q
  4.7        31         901        M.FPGSLSRGRR.A
  3.4        42         889        R.GQPVSLHLPGK.G
  1.2        70         892        K.FAPIVLTMPK.T
  0.3        85         880        R.SQKLSISAVIS.-
Top scoring peptide matches to query 1031
Elution from: 37.74 to 41.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 93531501.7 FinneganScanNumber: 2888
Score greater than 14 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.4        62       -1.70        K.SIKAFKESPK.Q
Top scoring peptide matches to query 1032
Elution from: 36.75 to 40.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1393400.7 FinneganScanNumber: 2718
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1033
Elution from: 37.95 to 41.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9200687.8 FinneganScanNumber: 2925
Score greater than 14 indicates homology
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.1        14         892        K.QIQVIFLFK.F
Top scoring peptide matches to query 1034
Elution from: 36.64 to 40.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 2701
Score greater than 14 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.8        27         898        K.IKQPNGSKHK.L
Top scoring peptide matches to query 1035
Elution from: 37.99 to 41.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2550761.4 FinneganScanNumber: 2930
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1036
Elution from: 40.18 to 44.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1285809.0 FinneganScanNumber: 3089
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1037
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1285809.0 FinneganScanNumber: 3086
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1038
Elution from: 36.56 to 40.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 749633.3 FinneganScanNumber: 2684
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.9        13         885        -.XEICGAPGVGK.T
  9.3        15         870        K.QPASAILSGSGR.A
  8.0        20      -14.01        R.MASLCLKPPK.T
  8.0        20         869        R.RPVAMVMPAR.R
  6.1        31        10.9        M.PGIKMAAWDR.S
  5.8        33       -1.09        M.KDTLGQAQQR.V
  5.7        33        14.5        R.APSMDRAAVAR.V
  3.7        53         860        K.EKPARDRSGK.T
  1.6        86         882        R.SGSQKRTHSR.V
  1.5        87         888        K.GSQGLPGFPGAR.G
Top scoring peptide matches to query 1039
Elution from: 36.72 to 40.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1259154.1 FinneganScanNumber: 2715
Score greater than 21 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.1       3.3      -14.35        R.GGYDHGGRGGGR.G
  8.1       4.2      -13.15        R.VGAGRGGAEENE.-
  6.4       6.3         895        K.MDETNQHGGR.D
  6.1       6.7        6.48        M.EEESDPGPGTK.E
  4.7       9.1         869        R.RLCCAGHDR.C
  1.3        20      -13.94        R.CGAAPVPTCGR.S
  0.8        23       -6.84        R.NSAEGTEYFK.M
  0.7        23       -4.11        R.GMHVCEDAVK.K
  0.4        25        5.72        R.SSLCFSAMDK.A
Top scoring peptide matches to query 1040
Elution from: 18.96 to 22.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 614047.4 FinneganScanNumber: 990
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       8.1      -15.74        K.VEMPSLKTPK.V
 11.8       8.7      -19.11        R.GTSVLAQQSVR.T
 11.2        10       -3.61        -.MGVGVGLGNGLR.L
 10.4        12       -3.58        R.KTKPGSMQPR.H
 10.3        12       -3.58        R.GCGLAPSLSKR.D
 10.0        13      -10.46        K.RVVSWQSQR.L
  9.9        13        2.88        R.SQERGSTPRK.E
  9.9        13      -15.77        R.VGVPSTMDLVK.S
  9.8        14        0.54        R.DLDDVLEKAK.K
  9.7        14        12.7        R.QQEEERKAK.H
Top scoring peptide matches to query 1041
Elution from: 19.06 to 23.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 614047.4 FinneganScanNumber: 997
Score greater than 30 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.3       1.9       -0.64        K.WKSDVALNGR.Q
 16.5       2.9       -6.93        R.RLESSGAGGRR.A
 16.0       3.3         867        K.CLPSVAAASIR.C
 15.5       3.7         885        -.MNPPAAFLAGR.Q
 14.5       4.6        12.7        R.SSASPKAAEAAR.L
 14.3       4.9      -19.09        K.ITGEDKAQKR.V
 14.3       4.9        12.7        K.EQEAKEKQR.Q
 13.9       5.3         883        R.EQEITAVQAR.M
 13.7       5.6         895        K.GAEEAERRAR.D
 13.7       5.6        6.24        R.ADAVLLMEAGR.L
Top scoring peptide matches to query 1042
Elution from: 21.03 to 25.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 824414.7 FinneganScanNumber: 1139
Score greater than 29 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.9       2.9        4.94        -.MASSGVKNTPR.W
 16.1       3.5      -10.52        K.EREIETSKR.V
 15.8       3.7         877        R.WVXKGSEDVR.L
 14.4       5.2      -10.55        R.RNESVTTVNK.K
 12.9       7.2         867        K.DGAAGHVGPLPR.Y
 12.7       7.7        14.7        -.XNLMAIVSDR.K
 12.4       8.2         864        K.STLAMSPRQR.K
 12.2       8.5         896        M.ERAMEQLNR.L
 11.8       9.3        9.05        K.LEEDKGDTLK.I
 11.8       9.4        8.31        K.MPEMSIKAPK.I
Top scoring peptide matches to query 1043
Elution from: 21.22 to 25.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 792431.2 FinneganScanNumber: 1156
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.7       1.2         864        K.STLAMSPRQR.K
  9.4        16      -11.30        K.NGMRMGQLLK.C
  8.7        19      -10.55        R.GSTISQSLAQR.C
  8.0        22      -14.05        K.TWSTNLANIK.L
  7.5        25         864        R.AAAAMAALERR.V
  7.2        27        17.7        R.AQTQEWKEK.H
  6.8        30         868        R.GTIPGSGITESK.D
  6.6        31         858        R.STPSSSPSLRK.R
  6.2        34         880        K.TRVAATGDEAR.V
  5.7        38         889        R.RSPGGAHPDPR.R
Top scoring peptide matches to query 1044
Elution from: 33.31 to 37.30 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 380811.8 FinneganScanNumber: 2253
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.0      0.91      -18.89        R.DSAVAISGADSR.G
 11.4       4.2         880        -.XEICGAPGVGK.T
 11.3       4.3       -3.42        MATGTPESQAR
 10.6         5         877        R.MLHWMVVAE.-
 10.4       5.2      -16.71        R.WLDACLAGSR.S
 10.0       5.7        12.0        K.MIVDMGSHSR.V
  9.1       7.1        17.9        R.APWDSWGSSR.L
  8.9       7.4         861        R.SGAERSGAGAER.A
  8.8       7.5        16.2        R.MPIEDSSPEK.G
  8.7       7.7        15.0        -.MFDTTPHSGR.S
Top scoring peptide matches to query 1045
Elution from: 36.09 to 40.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 43995599.3 FinneganScanNumber: 2608
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4       9.3        0.40        R.KQMLKFIAR.Y
  6.9        10      -15.03        K.LLHEKAAQIK.R
  6.4        12       -5.29        R.LTFSVTLKNK.R
  6.0        13        16.6        R.TAQGLRTLYK.R
  3.1        25         873        K.LTTXKIFRR.Y
  2.5        29        0.40        R.ILYVMRLAR.H
  2.2        30         892        R.IWTLFTGRR.R
  2.0        32        0.40        R.ALRILYVMR.L
  1.9        33         873        K.LSDRPLHALK.R
  1.9        33         854        R.AAPPGGVLRRR.G
Top scoring peptide matches to query 1046
Elution from: 36.09 to 40.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 43995599.3 FinneganScanNumber: 2605
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.5        28       -5.28        K.LVHEIGLELK.T
  2.2        31         882        R.LPHNRFLPR.F
  2.1        31        16.6        R.LVQHDLQVAK.Q
  1.3        38         892        K.NLFWASKKR.R
  1.1        40         883        K.LSKIEFEKR.Q
  1.1        40         883        -.XTEILGKSVR.I
  1.0        40        6.82        K.KGHVNVIVER.L
  0.8        42         857        R.LMKVFVTRR.I
  0.7        44       -2.94        K.KGPSSHRLLR.T
  0.5        45         892        R.ARSFITWLR.D
Top scoring peptide matches to query 1047
Elution from: 36.22 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 43995599.3 FinneganScanNumber: 2630
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.0       3.2         880        K.KSLKMSLQAK.W
  6.1        12         883        R.IQEAPKLTHL.-
  3.2        24        16.7        R.APASVLPAATPR.Q
  2.7        27        0.49        R.ALRILYVMR.L
  2.7        27         893        R.TLDTIQLAFK.M
  2.6        27         893        M.LVDLQYSLAK.S
  2.4        29        16.7        R.GKLSLSDKFR.K
  2.4        29       -2.85        K.KGPSSHRLLR.T
  2.4        29        0.49        R.KQMLKFIAR.Y
  2.3        30       -2.85        R.THKPDKLRR.L
Top scoring peptide matches to query 1048
Elution from: 36.43 to 40.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 44002856.9 FinneganScanNumber: 2662
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 25.1      0.15         854        R.SRVKPPPGRR.L
 11.8       3.4        6.93        R.TVAPSPRVAPR.A
  8.3       7.4         890        R.TKGTVTLMVLS.-
  6.9        10      -11.58        K.MFLIEKLIK.L
  3.8        21       -6.34        K.VLGGPPWLRR.T
  3.7        21        3.44        K.LFKPPQPPAR.M
  3.2        24        16.7        R.LVQHDLQVAK.Q
  3.0        26         890        -.MATIKSELIK.N
  2.9        26         879        -.MAFARRLLR.G
  2.9        26         873        R.FKELSTLRR.Q
Top scoring peptide matches to query 1049
Elution from: 39.14 to 43.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4502987.3 FinneganScanNumber: 3023
Score greater than 19 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.2       1.1         865        R.RVNHTLGPKK.N
  5.5        13         885        R.IQEAPKLTHL.-
  5.3        13       -3.72        K.AIPVDVALPQK.S
  3.0        23        8.40        R.SLQLNHALVR.G
  1.1        35         885        R.KELTDFLRK.L
  1.1        35        8.41        R.NLKLHLQER.I
  0.9        37        8.39        R.GGRVPLPIEGR.K
  0.8        38         881        -.MAFARRLLR.G
  0.8        38         885        R.KKFSVQSPTK.N
  0.6        40       -1.37        K.KGPSSHRLLR.T
Top scoring peptide matches to query 1050
Elution from: 39.10 to 43.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5036463.5 FinneganScanNumber: 3021
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5        13         885        R.RLFGTVLESK.V
  3.4        21        8.41        R.SLQLNHALVR.G
  0.8        38         890        K.MVRALFAVAR.C
  0.1        45         875        K.LKGSGLRYQK.L
Top scoring peptide matches to query 1051
Elution from: 25.81 to 29.81 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1465731.0 FinneganScanNumber: 1592
Score greater than 13 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.3        11        14.2        R.SPLSPGLIVLR.V
  0.2        11        4.46        R.SPVLQPVKKR.G
Top scoring peptide matches to query 1052
Elution from: 25.74 to 29.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1861155.4 FinneganScanNumber: 1584
Score greater than 18 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.0      0.91        4.65        K.LRVDIAVPLR.A
  5.0       3.7        1.17        K.LKYLAFLRK.R
  0.0        11         880        K.TSKSIFLKVK.V
Top scoring peptide matches to query 1053
Elution from: 25.12 to 29.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1456893.3 FinneganScanNumber: 1538
Score greater than 20 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.5       1.6        14.5        K.LLGPSKGAPLAK.R
  6.8       2.4        14.4        K.TVVLPPIVASR.G
  6.3       2.7         892        R.GLIVSVGPPRR.E
  6.2       2.7         892        R.KLLADIRGHK.M
  5.9         3        4.69        R.GDRVILILPR.V
  5.5       3.3         861        K.GLIKLVSKHR.A
  5.0       3.6        4.69        R.SPVLQPVKKR.G
  4.2       4.4         892        K.DPGRLLPKVR.L
  3.7         5        14.5        R.SPLSPGLIVLR.V
  1.3       8.5         892        R.QRKIELHVK.H
Top scoring peptide matches to query 1054
Elution from: 24.90 to 28.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2125936.9 FinneganScanNumber: 1513
Score greater than 13 indicates homology
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.3       5.3        5.43        K.LRVDIAVPLR.A
  0.1       8.8         881        K.TSKSIFLKVK.V
Top scoring peptide matches to query 1055
Elution from: 19.71 to 23.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 774164.1 FinneganScanNumber: 1039
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.6       3.7        18.6        K.KSMDDQEKR.S
 11.2       6.4      -13.00        K.QSMTEKEKR.K
 10.6       7.2      -13.01        K.RKMISTGENT.-
  9.7         9       -3.26        R.ISCKSVDESK.V
  8.7        11         855        R.XATPGTKEER.G
  4.0        33        2.41        K.LMIGSSNAMGR.L
  3.9        34         874        R.TDKKMDGGSGR.E
  3.8        35        17.4        R.GRGGGSGNFMGR.G
  3.8        35        12.9        R.SQTSTADSDLK.E
  3.7        35       -6.74        K.AYEMLSDPVK.R
Top scoring peptide matches to query 1056
Elution from: 19.71 to 23.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 774164.1 FinneganScanNumber: 1038
Score greater than 31 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.9      0.86       -3.26        R.ISCKSVDESK.V
 17.3       1.6        18.6        K.KSMDDQEKR.S
 15.4       2.4         854        R.MTLNVMTWR.R
 12.6       4.6        18.6        M.AQQQMTSSQK.A
 12.3       4.9      -13.00        K.QSMTEKEKR.K
 12.2         5         867        -.MSICDIEKR.Y
 11.7       5.6         870        -.MPTPSATGSFR.S
 10.3       7.8      -13.01        K.RKMISTGENT.-
  9.7       8.9         870        K.KSWGCGLESK.K
  9.5       9.3      -13.00        R.QAAMSNSSTKK.K
Top scoring peptide matches to query 1057
Elution from: 36.75 to 40.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 319901.0 FinneganScanNumber: 2719
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1058
Elution from: 36.75 to 40.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2655576.9 FinneganScanNumber: 2719
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.0       6.5         874        R.VYLGLSSMLR.V
 10.7       6.9        5.49        K.LPDATPTELAK.L
  5.6        23        17.5        K.SSDKQRPLQP.-
  4.3        30         883        R.SSNRIRHER.I
  4.2        31         871        R.EIRSPAAAPSR.S
  4.0        33         864        R.TMPLLSLHSR.G
  3.7        35         861        R.RSPSLSSKHR.K
  2.9        43         874        R.YGKMLVQATK.T
  2.8        43      -13.98        R.NEVVVQAAAVR.V
  2.7        44         880        K.NKQLPSAGPDK.N
Top scoring peptide matches to query 1059
Elution from: 36.47 to 40.44 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2655576.9 FinneganScanNumber: 2668
Score greater than 21 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9        11         889        K.HVAAGTAFPQR.T
  8.9        11         876        K.RGGTVHLVCR.D
  8.6        11         883        K.GREQPQQRR.N
  8.6        11         854        R.MLPPEQRKR.S
  8.3        12         883        R.HRARSESXGR.M
  7.4        15        1.40        R.IHVSNGLLMR.G
  7.2        16         874        R.VYLGLSSMLR.V
  6.9        17        17.5        K.AVNEPGSPTRK.V
  5.6        23         883        R.EGARPGRAQGR.G
  5.3        24         864        K.KEISHKPGMK.A
Top scoring peptide matches to query 1060
Elution from: 31.20 to 35.20 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1187385.2 FinneganScanNumber: 2062
Score greater than 31 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 57.2    0.0003       -0.43    2+  IPI00011654 K.LAVNMVPFPR.L
 15.1       4.9         869                    K.DRGTIVAQGGGK.A
 14.6       5.5        18.0                    R.WSRGRGVGER.G
 13.0         8       -6.62                    K.LANMNATIRR.I
 11.9        10         847                    K.DAIGEGKVTLR.I
 10.7        14         869                    R.GEKDLRLGDR.V
  8.1        25        5.95                    R.NLGSPQPPPPR.F
  7.3        29         875                    R.ALPSTWIENK.L
  6.9        33         869                    K.SVSLQEPRSR.W
  6.8        33         853                    R.SRSKLMAPPR.I
Top scoring peptide matches to query 1061
Elution from: 31.15 to 35.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1187385.2 FinneganScanNumber: 2053
Score greater than 31 indicates homology
Score greater than 35 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 46.3    0.0037       -0.43    2+  IPI00011654 K.LAVNMVPFPR.L
 15.8       4.1        2.48                    K.WPSSVLAFPR.I
 15.0         5       -2.58                    R.LLGPSETSSLR.N
 13.1       7.7         853                    K.GLLTQRAMPR.G
 13.1       7.8       -6.65                    R.VMLRQVQNR.A
 11.5        11      -12.26                    R.LSSEVEALRR.Q
 10.6        14       -6.64                    K.QLQQRSLMR.R
  9.1        20         859                    K.DRTRNVLER.S
  9.0        20      -12.26                    K.SSPTRNIEKK.K
  8.6        22         859                    K.RDQNKSAALR.Y
Top scoring peptide matches to query 1062
Elution from: 23.92 to 27.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 955424.8 FinneganScanNumber: 1392
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 28.8      0.17        2.90        R.ATVNSQEQKR.L
 22.2      0.79       -0.59        R.DLGSPQPPPPR.F
 20.7       1.1         849        R.NLGSPQPPPPR.F
 18.6       1.8        12.6        R.ATASALGTESPR.F
 18.2         2         868        M.GEMQGALARAR.L
 17.9       2.1        18.2        K.SAVEAMGSRPR.S
 15.3       3.9         868        K.SSLPACRNVR.R
 15.3       3.9        18.2        R.SSTPPSCRLR.R
 15.2       3.9        12.6        R.SSGVVAEGVEAR.V
 14.5       4.6       -7.96        R.RGGRGHVHER.Q
Top scoring peptide matches to query 1063
Elution from: 26.54 to 30.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 629121.8 FinneganScanNumber: 1662
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 24.3      0.44         879        K.SLRLEEQSAK.A
 14.3       4.4         879        K.LEQKAAGSASAK.R
 10.6        10         870        R.AVGGARSKTDAK.A
 10.4        11       -0.59        K.SLLVTELGSSR.T
  9.7        13         863        -.MAVSTGVKVPR.N
  8.8        16         879        K.EATKGQKEAAK.G
  8.6        16         857        K.SIHKRSFSAK.S
  8.1        18         879        R.LNTKATNVDGK.E
  6.9        24       -1.74        K.FASIARNQVR.K
  6.7        25         876        K.VINLSPFENK.E
Top scoring peptide matches to query 1064
Elution from: 26.54 to 30.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 629121.8 FinneganScanNumber: 1660
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.3         7         857        K.SIHKRSFSAK.S
  8.9        15         863        -.MAVSTGVKVPR.N
  8.2        18         875        K.TARREQLMR.E
  8.0        19         875        R.LGRRGLDSMR.E
  7.9        19         878        K.GRLWTERSR.E
  7.9        19      -11.01        R.RQLMTIIMR.S
  7.3        22         870        K.AATERLSLGSR.D
  7.0        24         854        K.AQAMLRVLSR.F
  6.3        28         866        R.GVPGPPGAVGPAGK.D
  6.2        28         879        K.RSGVEKEVEK.L
Top scoring peptide matches to query 1065
Elution from: 37.85 to 41.84 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4441538.7 FinneganScanNumber: 2906
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.7        24         864        R.MNLAIALTAAR.Y
  2.6        63      -14.40        R.AHFSRRFLK.H
  2.2        68         864        -.MAVSTGVKVPR.N
  1.8        76         876        K.VGKMRAGQAAR.G
  1.5        80         864        R.GAMEGILGIKR.T
  1.0        91        15.2        R.LELELTRCK.E
  1.0        92         857        K.AFSHSSKLRK.H
  0.9        93         869        R.RTPSRHPPGR.Q
  0.1   1.1e+02         882        K.LMLHGTVFAR.M
Top scoring peptide matches to query 1066
Elution from: 37.65 to 41.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4441538.7 FinneganScanNumber: 2870
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.4        52        5.52        K.AVRSVLANGMK.L
Top scoring peptide matches to query 1067
Elution from: 37.54 to 41.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4441538.7 FinneganScanNumber: 2856
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.7       4.9         880        R.LLGSASPSSSVR.L
 10.0        11         847        R.TGLHRGPGLPR.A
  8.7        16        9.54        K.VDSPTVTTTLK.N
  8.4        17         864        -.MAVSTGVKVPR.N
  8.1        18         864        K.LKQLDQKCK.Q
  8.1        18         864        R.LLKENQMLR.R
  7.6        20         880        R.IRINTTADEK.D
  7.3        21         854        R.RLITMEKNR.D
  7.0        23         866        R.VWRRGFSPR.T
  7.0        23         848        R.TISGTTKSLPR.W
Top scoring peptide matches to query 1068
Elution from: 38.14 to 42.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1401306.2 FinneganScanNumber: 2945
Score greater than 14 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.3        26         877        R.EIPRARGHVK.E
Top scoring peptide matches to query 1069
Elution from: 38.14 to 42.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 900331.3 FinneganScanNumber: 2947
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.1        18        16.2        -.XLRPPDLAQR.V
  1.6        20        16.2        R.TPVAPRALSPR.R
  1.4        21         882        M.GVSKLDILYR.R
  1.3        21         860        R.LKKELELYK.E
Top scoring peptide matches to query 1070
Elution from: 30.71 to 34.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 568335.1 FinneganScanNumber: 2019
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.0         3      -10.05        R.SPDGAVHVVER.S
 14.6       4.1         882        R.RDLYGQCPR.T
 14.1       4.7         867        K.LMELNMEIR.D
 13.7       5.2      -19.28        K.CKVMLTELR.G
 13.6       5.2      -19.28        K.LMSIMGNVLR.F
 12.2       7.3         842        R.LQKMGESSLR.N
 11.8       7.9         868        K.SASSSEELINK.L
 11.8         8       -1.14        K.SCFLCLPLR.A
 11.0       9.6         845        K.LAAKTDEFNR.T
  9.6        13       -0.40        K.VGTESGYSPLR.Y
Top scoring peptide matches to query 1071
Elution from: 22.85 to 26.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 290583.0 FinneganScanNumber: 1316
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.5       5.8       -0.51        K.TPLRPLDPTR.L
  8.4       9.6        11.5        R.KASSPNLHRR.Q
  4.2        25         845        -.XLRPPDLAQR.V
  3.9        27         862        R.SSLLSLMTGKK.D
  3.1        32         879        R.RRRPSHEAR.R
  3.0        33        17.6        M.FYSVRPGALR.V
  2.0        41        14.7        K.TTFIRMLAGR.L
  1.2        50      -10.13        K.RKLAAHDNLK.L
  1.1        51      -12.45        R.LDYLSSLKVK.G
  1.0        52        1.82        R.RGSAAAHRALR.R
Top scoring peptide matches to query 1072
Elution from: 38.14 to 42.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1096906.6 FinneganScanNumber: 2944
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5       5.8         871        K.TLRPTPARPR.N
  1.3        19      -15.14        R.LRVPVRAQAR.A
  1.1        20         881        -.XLRPPDLAQR.V
  0.7        22         881        R.ALLAGGGGPPAKR.R
  0.6        22         881        R.TPVAPRALSPR.R
Top scoring peptide matches to query 1073
Elution from: 26.78 to 30.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2467845.5 FinneganScanNumber: 1689
Score greater than 16 indicates homology
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.0       3.6        3.65        R.LVSHVIRTLK.T
Top scoring peptide matches to query 1074
Elution from: 26.80 to 30.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2467845.5 FinneganScanNumber: 1693
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1075
Elution from: 26.89 to 30.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2467845.5 FinneganScanNumber: 1700
Score greater than 17 indicates homology
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.5       1.3        3.66        K.VNVPLNIIRK.A
  4.1       2.8        3.65        R.VLVLLNPRGGK.G
  0.6       6.2         871        R.VLGRTRLPPR.L
Top scoring peptide matches to query 1076
Elution from: 26.87 to 30.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2911625.2 FinneganScanNumber: 1697
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1077
Elution from: 26.87 to 30.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2911625.2 FinneganScanNumber: 1698
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.3     0.084         871        R.HIRKLLSAAR.L
  9.2      0.85        13.8        K.ILKPSIPLER.I
  0.6       6.3        4.11        R.VLVLLNPRGGK.G
Top scoring peptide matches to query 1078
Elution from: 26.91 to 30.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2911625.2 FinneganScanNumber: 1704
Score greater than 13 indicates homology
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.1       4.4         859        K.GKKVAPAPAVVK.K
  0.4       6.6        13.8        K.ILKPSIPLER.I
Top scoring peptide matches to query 1079
Elution from: 34.72 to 38.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1008545.8 FinneganScanNumber: 2399
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.0       2.7       -4.46        K.MLANFLASRK.S
 14.7       3.6      -19.68        R.SITAAKYREK.Q
 14.7       3.6      -14.11        R.LMXHLQRQK.X
 13.3       4.9        1.86        K.QSSHLTTHKK.I
 13.3       4.9        11.5        K.TSAKALYEQR.K
 13.3         5        5.15        R.VFMVDVKANK.H
 12.8       5.6        17.1        R.SLCAREFRK.L
 12.6       5.8        5.16        K.QAFLLSSCLK.K
 12.3       6.2         860        R.LMGAFASLDLK.S
 12.3       6.2        5.17        R.EAVFKMLSNK.E
Top scoring peptide matches to query 1080
Elution from: 34.72 to 38.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1008545.8 FinneganScanNumber: 2402
Score greater than 30 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.0       1.3       -4.46        K.SLVMELRYR.D
 18.8       1.4       -4.45        K.IKMNGKAYNK.K
 16.8       2.2        5.17        R.EAVFKMLSNK.E
 15.7       2.9      -17.56        K.MQLLLHHFK.E
 15.6       2.9       -7.75        R.AEGRAPNPARK.A
 15.5         3      -17.41        R.APRPATRGGGAR.W
 14.8       3.5       -1.58        R.KTGDYLWRK.Y
 13.7       4.6        11.5        K.GTGASGSFKLNK.K
 12.9       5.4         878        K.QATYRERNK.T
 12.9       5.4         847        R.EATAAPHGKRK.R
Top scoring peptide matches to query 1081
Elution from: 36.20 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10076215.6 FinneganScanNumber: 2625
Score greater than 21 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8       3.5         861        R.ALPGLLEARAR.T
  7.7       4.6         871        K.TPGVPAIGSLVR.C
  5.3       7.9        13.5        R.LRKYAFELK.M
  2.8        14         849        K.ALPILEELLR.Y
  2.5        15         867        K.RFIIEITFK.F
  2.4        15         871        K.KEPIQPSVLR.R
  2.4        15         879        R.APPQFVVRPR.D
  2.2        16         861        K.VLGKAVHSLSR.I
  1.8        18         858        R.AQPWALLLVR.V
  1.3        20         861        K.APGIIPRTSVR.E
Top scoring peptide matches to query 1082
Elution from: 36.25 to 40.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10076215.6 FinneganScanNumber: 2632
Score greater than 19 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.5       4.8         876        K.VPSRMVPRPK.D
  7.1       5.2        17.0        K.KTLVDLHVSR.N
  6.5         6         861        K.KTLPKSHLSR.V
  5.2       8.1         871        K.EVHKEGVIKK.D
  5.1       8.3         861        K.TKQLHQKVGK.G
  4.6       9.3        17.0        K.ISQKHINSIK.S
  4.0        11      -14.21        K.RKIAVVQPEK.Q
  4.0        11        13.5        R.AVGFVHSPLLK.N
  4.0        11        13.5        R.GLGFVHSPLLK.R
  3.6        12        17.0        R.RNLEVKPSPK.I
Top scoring peptide matches to query 1083
Elution from: 36.38 to 40.38 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10076215.6 FinneganScanNumber: 2658
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.0       4.3        13.5        K.AFLVYGKLTR.H
  7.8       4.4        17.0        R.LGLPNKDGVVR.F
  6.9       5.4         879        R.FISRNVFKR.T
  6.2       6.4         879        R.FVTRNVFKR.T
  5.4       7.7      -14.18        K.RKIAVVQPEK.Q
  5.1       8.4         879        R.RGWVPLVSPR.C
  4.1        10        13.6        R.KRFFESIIK.E
  4.1        10        17.0        K.LLAGGHKKESK.V
  4.0        11       -4.56        K.NLDLILPTLR.N
  3.9        11      -14.18        R.ANAVVLIKPSR.S
Top scoring peptide matches to query 1084
Elution from: 17.90 to 21.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 201146.2 FinneganScanNumber: 920
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.4       5.1         859        R.LFSCGADGTLK.T
 10.8       7.4         865        R.GPSDTSSRFSK.E
 10.2       8.5         869        K.EEAVFEAVMK.W
  9.5        10         859        K.NEGMSGLFGLK.Q
  8.6        12         874        R.EIHQDWANR.E
  8.4        13       -8.44        K.SYRLTSDAEK.S
  6.6        20         840        K.IDFEEQFLK.E
  4.9        29        6.75        K.SFNCNSSLIK.H
  4.9        29         862        K.VFDFAGEEVR.V
  4.8        29        9.63        K.KHPTEDWEK.D
Top scoring peptide matches to query 1085
Elution from: 36.32 to 40.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3631575.9 FinneganScanNumber: 2649
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.2       7.9        17.5        K.MRMISHIIR.E
  9.9        13        17.5        K.MRMISHIIR.E
  9.9        13         859        R.LADALNATARR.L
  6.8        27         859        R.QEIKAQKGNR.W
  6.7        28         847        K.KGTSKTPVPEK.V
  6.1        32         847        K.IANELLLTER.A
  6.0        33         849        R.TRAAPATATRR.R
  5.9        34         847        R.ELKALEEALR.A
  5.5        37         865        R.SEVVGPFPLAR.S
  5.1        40         849        R.RRLAADGSLGR.L
Top scoring peptide matches to query 1086
Elution from: 36.20 to 40.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 17166670.5 FinneganScanNumber: 2622
Score greater than 20 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.5        19         867        MKRGTSLHSR
  7.3        25         851        R.SQGRLEAQKR.E
  6.9        27         861        M.ETILEQQRR.Y
  6.5        30         871        K.ELQKELQER.L
  5.9        34         840        K.KIQEAASQGLK.F
  5.7        36      -16.17        R.LLAVTMPSVAR.H
  5.6        37         876        R.DTLQPGMRVR.M
  4.8        44      -19.44        M.ASRSLGGLSGIR.G
  4.5        47        8.16        K.HGEKLYTGLR.E
  4.5        47        11.6        K.TKGTAGPGSGGKR.E
Top scoring peptide matches to query 1087
Elution from: 36.89 to 40.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1204593.8 FinneganScanNumber: 2742
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.8      0.61         873        R.KGKNGVAIMSR.L
  8.5        10        17.5        K.FKTIEEVVGR.A
  7.9        12         855        K.VVKTALDAFGR.I
  7.5        13         863        R.WKLAPRYSR.R
  4.8        24         855        K.EVFRKQLEK.A
  4.0        29         870        K.CLHKSLYKK.D
  3.3        34         873        R.RLITMEKNR.D
  3.1        36         845        R.LQELPGKVHR.F
  2.2        44        11.2        K.TLPMVPFKTK.D
  2.0        46         855        K.KTFTPNIISR.K
Top scoring peptide matches to query 1088
Elution from: 36.36 to 40.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 128439608.7 FinneganScanNumber: 2654
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.1        14         845        K.AFSRNSLLIR.H
  4.5        26         845        R.LQELPGKVHR.F
  2.7        39       -1.49        R.KRPSVPPSPGR.L
  2.4        43      -13.31        K.ELTAKISFLR.Q
  1.7        50         873        R.RLITMEKNR.D
Top scoring peptide matches to query 1089
Elution from: 36.36 to 40.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 128439608.7 FinneganScanNumber: 2652
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.6       8.1         873        R.RLITMEKNR.D
  6.2        18        8.04        R.LGLSPGPGLGGPR.I
  4.9        24         873        -.MLSAASRVVSR.A
  4.4        27         835        R.RLLQSAHPVR.V
  4.2        28         867        K.MRKMIEQLK.R
  3.2        35         855        R.LQLLYSNGIR.T
  2.7        39         845        K.IGSVPGIHQLR.D
Top scoring peptide matches to query 1090
Elution from: 36.47 to 40.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 128344189.2 FinneganScanNumber: 2670
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.7        31         845        K.SMTILVLMLR.E
  0.7        63         866        R.SLSLGRAAHHK.Y
  0.1        71         836        R.KPYRSLTRR.R
Top scoring peptide matches to query 1091
Elution from: 36.50 to 40.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 128344189.2 FinneganScanNumber: 2678
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.9        47         866        R.SLSLGRAAHHK.Y
  0.6        64         855        R.LQLLYSNGIR.T
Top scoring peptide matches to query 1092
Elution from: 39.38 to 43.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16118335.7 FinneganScanNumber: 3039
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.8        25         845        K.YQRLLEKAR.E
  4.5        26         858        R.TRSLSSLREK.G
  4.2        28         855        K.VLNSTVQFLR.Q
  4.1        29         846        K.SMTILVLMLR.E
  4.0        30         852        K.SVLVMAGSLKR.E
  3.7        32         845        K.TFRVLQSVAR.I
  3.6        33         873        LDQTIMRKR
  3.5        33         864        K.TMRRNTILR.Q
  3.2        36         855        R.LQLLYSNGIR.T
  3.1        37         845        R.LQELPGKVHR.F
Top scoring peptide matches to query 1093
Elution from: 39.38 to 43.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16118335.7 FinneganScanNumber: 3038
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.0       9.4         873        -.MLSAASRVVSR.A
  5.2        22         855        K.FIAQLQTSIR.E
  4.2        29         862        K.VESKEKVMVK.K
  4.1        29         855        K.VVYLEELRR.R
  2.3        44         855        K.YLAQLLNSVR.L
  1.6        52        5.50        K.MLLTGGKSSRK.N
  0.2        72        8.36        R.DKQGRGLLYK.S
Top scoring peptide matches to query 1094
Elution from: 38.17 to 42.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 128439608.7 FinneganScanNumber: 2951
Score greater than 14 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.4        41         845        R.LQELPGKVHR.F
  1.0        57         867        K.RGPVHTAVPSR.L
Top scoring peptide matches to query 1095
Elution from: 24.97 to 28.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 286168.4 FinneganScanNumber: 1518
Score greater than 18 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8       2.1        12.1        K.VRGVAPLRGPR.R
  7.6       2.2         847        R.LTQHVPLLKK.T
  5.1       3.9       -9.30        K.RKAAPVPGLLR.F
  4.9       4.2         856        R.KGPELPLVPVK.R
  3.2       6.2         868        K.TLKGAVYRIR.G
  3.1       6.3         849        K.HRLLRVVQR.L
  1.4       9.2         868        K.LGVKLGPHLSR.A
  0.9        10        0.24        R.LLHDKGLLLR.L
  0.9        10         871        K.KLPGVMLFKK.K
  0.6        11         871        R.IISLLAFIMR.A
Top scoring peptide matches to query 1096
Elution from: 36.85 to 40.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1023467.5 FinneganScanNumber: 2737
Score greater than 16 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1097
Elution from: 38.17 to 42.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8425412.0 FinneganScanNumber: 2954
Score greater than 16 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.6       9.4        14.5        K.QYFLGILKAK.G
Top scoring peptide matches to query 1098
Elution from: 38.17 to 42.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8425412.0 FinneganScanNumber: 2951
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1099
Elution from: 36.91 to 40.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 887168.2 FinneganScanNumber: 2751
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1100
Elution from: 29.08 to 33.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 558499.2 FinneganScanNumber: 1878
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.9      0.34        11.2        K.SPAPKVRKPGR.K
 11.6       0.9        17.2        R.FITLLPHVPR.C
 11.3      0.96       -9.92        K.LKGKLPPGAGVR.E
  7.7       2.2        11.2        R.VRHVAAASLIR.L
  6.9       2.7        11.2        R.VHLVVSRQVR.Q
  5.8       3.4         856        R.LHTLLPQTLR.N
  5.8       3.5         847        K.AKLNLIQHVR.S
  4.5       4.7         847        R.VRIHALLVDR.Y
  4.0       5.3        7.80        M.WIPVVGLPRR.L
  3.6       5.7        11.2        R.SLLHQRLAVR.E
Top scoring peptide matches to query 1101
Elution from: 29.13 to 33.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 252287.1 FinneganScanNumber: 1885
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.7        11         857        R.QPAPGLLGAVLR.S
  0.3        12         850        R.GFLIKMGGKIK.T
  0.2        12         859        R.RGRLHGQVLR.L
Top scoring peptide matches to query 1102
Elution from: 29.08 to 33.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 420663.1 FinneganScanNumber: 1879
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.8       1.6         832        K.LKGKLPPGAGVR.E
  4.2       4.7         853        R.SLLHQRLAVR.E
  0.8        10         832        K.KLIPNPNKIR.K
Top scoring peptide matches to query 1103
Elution from: 20.74 to 24.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 193516.6 FinneganScanNumber: 1116
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.4       1.3       -9.09        K.ETKMLMAAGDK.D
 13.9       3.6         856        R.MNEGPLEMIK.L
 10.7       7.8         828        K.LFEMQPVSDK.Y
  9.7       9.6         841        -.MDEALETQLK.T
  9.4        10       -9.09        K.MLVNLMAENK.A
  8.0        14         832        K.MLLSQNESQK.I
  6.5        20         832        K.MTNEIQSNLK.C
  6.1        22         834        K.EYDLPDAKSR.A
  6.1        22       -3.63        K.MACVLARMDK.A
  5.9        23      -15.71        K.FGGSLSTICPR.D
Top scoring peptide matches to query 1104
Elution from: 36.40 to 40.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 36546914.7 FinneganScanNumber: 2659
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.2        13         835        R.GYLVKMGGKIK.S
  4.8        15         832        -.XVPPARSVSPR.S
  4.4        16        6.64        R.TLSSIPRPAPR.G
  0.8        36         849        R.RPAHAYLLPR.I
  0.8        37        3.27        R.NLPLPPPPPPR.G
  0.3        41         841        R.ATGAALLVAPGPR.S
  0.3        41      -14.42        R.IIHDSLQLKK.R
  0.0        44         856        R.LRYMLLGGVR.T
Top scoring peptide matches to query 1105
Elution from: 36.47 to 40.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 36534537.6 FinneganScanNumber: 2671
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.5       6.2         853        M.HQLSLIRGNR.G
  7.1       8.7         856        R.LRYMLLGGVR.T
  6.5       9.9         832        K.TVHELIRGLR.M
  2.2        27         841        R.KQTRLYSAVK.E
  2.2        27        12.7        R.LKNLPFSFTK.L
  2.2        27         859        R.LWVAPQAPVGR.F
  2.2        27       -2.72        M.RISLPRAPER.D
  2.0        28         856        R.IXLNMFKKR.T
  2.0        28       -8.94        R.ILRLAPVPCR.C
  2.0        28      -14.41        K.ILTDLKVQHK.R
Top scoring peptide matches to query 1106
Elution from: 36.53 to 40.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 36543070.5 FinneganScanNumber: 2682
Score greater than 16 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.1        17        12.2        R.MLLRAHKPGR.S
  3.5        20         844        M.VVMGVVLYLGK.K
  3.5        20        16.1        K.HGSKLVPESLK.K
  3.4        20         851        R.LFSKSIETLR.V
  3.4        20         841        R.VLLQTPAAPQR.C
  2.5        25        16.1        K.LSTSRDFKIK.G
  2.4        25         826        R.FMKLLLTRR.A
  2.3        26         841        K.TYVKGTQKLR.V
  2.3        26         853        R.ILRSNQHGIR.R
  2.1        27         851        R.SVTVLLAATYR.T
Top scoring peptide matches to query 1107
Elution from: 36.85 to 40.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 36543070.5 FinneganScanNumber: 2738
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.6       7.7         832        -.XVPPARSVSPR.S
  4.0        17        12.7        R.VSVYPFTLIR.T
  3.4        20        15.0        R.ATFRQLFRR.V
  2.8        23         860        K.LYKLALEESK.K
  2.3        26       -2.67        M.RISLPRAPER.D
  2.2        27       -8.88        R.ILRLAPVPCR.C
  1.9        28      -12.09        R.LAPRLAGRQGR.Q
  1.9        29        16.1        R.AAPDILIATPGR.L
Top scoring peptide matches to query 1108
Elution from: 38.17 to 42.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 36546914.7 FinneganScanNumber: 2952
Score greater than 19 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3       7.7        17.8        R.SKEVRYVVSK.A
  5.9        11        8.39        K.KKGPVQPAGGQK.G
  4.4        15       -4.38        K.RINTRFFLK.H
  0.8        34        17.8        R.LAQAISIPEPR.V
  0.3        38      -10.41        R.LASPRGGRRPK.R
Top scoring peptide matches to query 1109
Elution from: 39.42 to 43.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3735712.1 FinneganScanNumber: 3043
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.9       3.3         834        R.ALLSRGPVPGAR.Q
  4.5        15         855        R.ALRPAARDPAR.E
  1.9        26        17.9        K.HGSKLVPESLK.K
  1.3        30         855        MWYLAKLIR
  1.0        33        14.6        R.LKNLPFSFTK.L
  0.7        35         834        K.TVHELIRGLR.M
  0.6        36        8.53        R.IALSEHLKQR.R
  0.5        37       -3.12        K.KSIESVLYKK.H
  0.4        37       -0.87        M.RISLPRAPER.D
  0.4        37         834        R.SQLLPQPRVR.S
Top scoring peptide matches to query 1110
Elution from: 40.02 to 44.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3481794.8 FinneganScanNumber: 3074
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.0       6.5        11.8        K.YIMLEIKLR.N
  6.7       8.9        18.0        R.AAPDILIATPGR.L
  5.3        12         834        R.SQLLPQPRVR.S
  2.2        25        8.60        K.HLTLNNKVQK.K
  0.5        37         843        R.LKLQNELAHK.V
  0.3        38         843        R.KHLTVPKENK.I
  0.1        40         858        R.IXLNMFKKR.T
Top scoring peptide matches to query 1111
Elution from: 40.98 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1701424.8 FinneganScanNumber: 3151
Score greater than 16 indicates homology
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.4         2         820        K.SYRCHECGK.A
  3.5       2.5         826        R.MNCLDCLDR.T
  3.3       2.6        18.7        -.MEEEAMNGDR.T
  2.3       3.3      -17.88        K.DMMDPVAVCK.K
  1.0       4.5         821        -.MPMESASSDNK.K
  0.0       5.6         826        R.QLCEMEACR.L
Top scoring peptide matches to query 1112
Elution from: 41.00 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1701424.8 FinneganScanNumber: 3152
Score greater than 17 indicates homology
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.7       0.3         842        K.MMMMSMMKK.V
  3.8       2.3        13.3        R.TEASEDDMGDK.A
  1.8       3.7      -17.88        K.DMMDPVAVCK.K
  1.6       3.9        0.52        K.SWDDETDMAK.L
Top scoring peptide matches to query 1113
Elution from: 22.45 to 26.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 424815.6 FinneganScanNumber: 1270
Score greater than 18 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4       1.9      -11.18        K.FMRFMMMR.A
  4.8       3.5       -7.10        R.SCGMGVQSAER.Q
  1.8       6.8      -18.70        K.IMTACSEEEK.Q
  1.6       7.1      -15.90        R.EQFPGSEMEK.Y
  1.6       7.2        10.6        R.GNMMADHYSR.F
  1.5       7.4       -7.08        R.ACAACSSLDSR.A
  1.0       8.4      -14.38        R.RMHAGCXYR.R
Top scoring peptide matches to query 1114
Elution from: 22.50 to 26.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 424815.6 FinneganScanNumber: 1275
Score greater than 13 indicates homology
Score greater than 23 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.9       2.2      -11.18        K.FMRFMMMR.A
  1.1       8.2      -11.18        K.FMRFMMMR.A
  0.5       9.3         824        R.DCHHQACLR.R
  0.4       9.6         841        K.RTEMEEDDR.D
Top scoring peptide matches to query 1115
Elution from: 36.96 to 40.96 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1787381.6 FinneganScanNumber: 2757
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.6         2      -19.16        K.DEVLKIMPVR.K
 14.6       3.9         833        -.MIVAAEAVAAPR.C
  9.3        13        19.6        R.RGNRAAASSPGR.T
  7.9        18        17.3        K.SNLTSPQTVPR.L
  7.0        23         844        R.MAAARAAPAAAAR.G
  6.5        25         853        R.AIEAGIWWPR.T
  5.3        33        7.84        R.LFKLPPGPEAM.-
  4.5        40       -1.38        K.EIKGQQGRQR.N
  4.3        41         818        R.LQQIAAALENK.V
  2.5        63        8.03        K.QERAAAAAAAAAK.N
Top scoring peptide matches to query 1116
Elution from: 36.89 to 40.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1787381.6 FinneganScanNumber: 2743
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.4       5.1         857        R.ALVSAGNPGAWR.G
  9.0        14        1.83        R.VPRPEMGSKAK.K
  8.9        15         857        R.LQENPGAWKR.G
  8.6        15         844        -.MPKARQSPGAR.G
  7.8        18         839        R.NGLAALDANIAR.L
  7.6        20         848        R.LAGLTEPEAAAR.F
  7.2        21        1.83        K.TNNHIMKLTK.G
  6.9        23         839        K.GQIGPIGEKGSR.G
  6.6        25         826        R.VHTGEKPFKR.G
  6.0        28      -13.00        K.QLAIGVNEVTR.A
Top scoring peptide matches to query 1117
Elution from: 38.02 to 41.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3048656.0 FinneganScanNumber: 2933
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.8        22        2.07        K.AKKMFLKPQD.-
  3.5        46         816        R.QAFRIKGAASR.Q
Top scoring peptide matches to query 1118
Elution from: 37.68 to 41.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3048656.0 FinneganScanNumber: 2879
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5        29         851        R.IIEVVDAIMTT.-
  4.3        39         826        K.FDEALKLRGR.S
  3.5        47         835        M.YQASAVSLLPR.D
  3.1        51         853        K.VNEMSAILRR.I
  2.1        64         844        R.RTLMERVQR.M
  2.0        65       -1.27        IFIALAWMPK
  1.6        71         853        -.MSPSLVRATAR.A
Top scoring peptide matches to query 1119
Elution from: 37.71 to 41.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3048656.0 FinneganScanNumber: 2884
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.8        27        14.7        -.MASVLNVKESK.A
  5.5        29      -10.44        R.YGRLVSRQAR.V
  3.4        48        13.6        K.AMASLKRWXR.H
  2.8        55       -7.25        K.AMAVPYLLRR.K
  1.6        72        5.42        R.NKEVTRALMK.I
  1.4        76        11.4        -.MSPVFGLLVDK.T
  1.1        80         826        K.TRLFALGSSPR.C
  0.9        84      -10.45        R.QFTRQRITR.V
  0.9        85         853        K.IEMDKRQLR.A
  0.7        88         853        -.MSPSLVRATAR.A
Top scoring peptide matches to query 1120
Elution from: 33.51 to 37.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 334924.9 FinneganScanNumber: 2273
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 43.8    0.0034       -0.09   14   IPI00910412 K.FTIQLQLSQK.S
 21.4      0.59         839                    R.DLSSVQTLLTK.Q
 18.8       1.1        18.0                    R.GMRXKDSGLTK.R
 18.8       1.1        18.0                    R.GMRXKDSGLTK.R
 18.3       1.2         838                    R.TFLRQALEAR.L
 11.7       5.5         827                    R.YALPIPSSKTK.N
 10.9       6.6        12.6                    K.LLSLASTASSQK.F
 10.4       7.4         851                    K.KTNQSSKNIGK.K
 10.1       7.9        18.0                    K.DKSLRIMSQK.F
  9.3       9.4      -15.55                    R.GIFMAKVPKSK.A
Top scoring peptide matches to query 1121
Elution from: 33.47 to 37.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7407005.6 FinneganScanNumber: 2267
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.9       0.3        6.18        K.TFIAVLSLSKE.-
 18.1      0.93       -3.13        R.LHLEVQVLEK.Y
 18.0      0.94         822        R.LKETLLFSAGK.G
 14.7         2         813        M.LVYNTVRLTK.S
 14.1       2.3        17.7        R.HLLDRDPLTK.S
 13.0         3        11.6        K.ACIPYLKKSK.V
 12.3       3.5         822        K.TPLVSPPGPLTK.G
 12.2       3.6         843        R.YLRGGAITEVK.R
 11.7         4         813        K.IFTLSRATAVK.E
 10.8       4.9       -3.14        R.EVVQKKTFTK.W
Top scoring peptide matches to query 1122
Elution from: 21.19 to 25.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 468444.2 FinneganScanNumber: 1153
Score greater than 29 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 33.0     0.051        0.00    1   IPI00301263 R.ASDPGLPAEEPK.E
 14.9       3.3      -15.40                    K.DENIMGLFKK.T
 14.0       4.1         810                    K.NGVVMPDHGKR.R
 12.6       5.7      -15.39                    -.MAAASYDQLLK.Q
 11.2       7.6      -15.40                    K.MGKIDIDYQK.L
  9.1        12      -18.20                    R.TIMLMGVSSQK.I
  9.0        13       -3.51                    MMGLGLMAKDK
  7.2        19      -10.00                    R.LYISRMMHK.S
  7.2        20         814                    R.LEQEIATYSR.L
  7.0        20         813                    -.PTGHGWALSQR.A
Top scoring peptide matches to query 1123
Elution from: 21.25 to 25.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 468444.2 FinneganScanNumber: 1157
Score greater than 30 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 32.1     0.062        0.00    1   IPI00301263 R.ASDPGLPAEEPK.E
 15.3         3        11.5                    K.APSESAALDGHR.L
 12.4       5.9         817                    R.LQQATKMMSR.R
 11.7         7         816                    R.SSPPRAAGHSSR.K
 11.5       7.2         817                    R.LQQATKMMSR.R
 11.4       7.4      -13.21                    R.RPPVPCGQGSR.S
 11.3       7.5        2.60                    M.SSVQKMMQAGK.K
 10.2       9.7        2.60                    M.SSVQKMMQAGK.K
  9.9        10         826                    K.DGLLKATCGMK.V
  9.4        12      -18.58                    R.NVDLDLAASHR.K
Top scoring peptide matches to query 1124
Elution from: 36.56 to 40.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7335966.3 FinneganScanNumber: 2683
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.5       4.4        13.0        K.VRLTFFTLSK.N
  8.2         6      -17.02        K.YVTILHLPKK.G
  5.3        12        7.10        R.ALPARLAEKSR.A
  4.7        13      -13.70        M.VRINVLADALK.S
  3.2        19         830        K.VKIAGPGLGSGVR.A
  3.1        19        16.3        K.NAIQIVQQAVK.Y
  3.0        20        16.4        R.ASPQLREAVLK.L
  3.0        20         826        K.LKHPNIITFK.G
  3.0        20        16.4        R.LSPAARNILEK.H
  3.0        20        7.07        R.VLKNANIVQGR.R
Top scoring peptide matches to query 1125
Elution from: 36.53 to 40.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7335966.3 FinneganScanNumber: 2681
Score greater than 19 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3       7.3      -13.68        K.KKSLSAISIHK.R
  6.3       9.1      -13.68        R.QLLLRELQAK.Q
  5.6        11      -13.70        R.SQLASVPKILR.E
  4.1        15       -2.19        R.GRRPRSELLK.A
  2.5        22       -2.19        R.LQIIQRERR.R
  1.8        26         826        K.LKHPNIITFK.G
  1.7        26         830        K.IPPARVTLTSR.T
  1.7        26         830        K.LHSVTTKLVGR.V
  1.7        27         830        R.KLEALIRDPR.S
  1.4        29         817        R.LGAPLPFRAIR.V
Top scoring peptide matches to query 1126
Elution from: 36.89 to 40.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7335966.3 FinneganScanNumber: 2744
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.6       5.5         839        R.VPGLTQAVQVAK.M
  8.1       6.1      -13.66        K.KKSLSAISIHK.R
  7.8       6.6        7.12        R.ALPARLAEKSR.A
  5.3        12      -13.68        K.GKPEAAKKGVVK.A
  4.8        13        7.08        K.VTVRGLEPGRK.Y
  3.9        16        9.17        R.RWLPKKPMR.L
  3.2        19      -13.69        R.LQLTLRQLVQ.-
  3.1        19        15.3        -.XWRSALRGLR.C
  3.1        19        7.08        R.VLRVENVQVR.D
  2.9        20         818        K.IVPPKSLEISK.D
Top scoring peptide matches to query 1127
Elution from: 40.96 to 44.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1785680.1 FinneganScanNumber: 3144
Score greater than 17 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1128
Elution from: 40.98 to 44.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1785680.1 FinneganScanNumber: 3148
Score greater than 17 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1129
Elution from: 40.96 to 44.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1785680.1 FinneganScanNumber: 3147
Score greater than 17 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1130
Elution from: 41.07 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1785680.1 FinneganScanNumber: 3161
Score greater than 17 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.2       2.1         813        K.MMMMSMMKK.V
Top scoring peptide matches to query 1131
Elution from: 36.56 to 40.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2145055.3 FinneganScanNumber: 2688
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.9        32         816        K.NLSVVILGASDK.D
  5.5        35         831        R.QTMPAKPSLVK.R
  5.0        39         815        K.RGLHVKASGYK.V
  4.8        41        11.6        K.MIKETLPNVR.V
  4.3        46         825        R.LYGAAGPGAGLLR.R
  3.9        50         818        R.IPGSVLMFPVR.A
  3.7        52        11.6        R.LLEQMGALAVR.G
  2.8        65         837        K.LPSEKNSNKAK.T
  2.6        67         816        R.KLSEKPKEEK.K
  2.6        68        2.38        -.MVRTSSPGILR.V
Top scoring peptide matches to query 1132
Elution from: 36.57 to 40.57 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2145055.3 FinneganScanNumber: 2689
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9        16       -4.09        R.HVRAPTPSPVR.S
  7.8        21         842        K.APEMKSRRPK.S
  6.2        29         816        K.NLSVVILGASDK.D
  6.2        30        5.16        R.QPGIHPKTPNK.F
  4.9        40       -4.07        K.AGVPLRYRER.H
  4.0        49        17.7        R.VDQGAATALSRK.D
  1.5        87       -2.96        R.LEQKSGELGKK.I
  1.4        89         831        K.QTKLLEMQPK.E
  1.3        91        17.7        K.KNQETISQLR.K
  1.3        92      -18.28        R.NKEVINIMKK.I
Top scoring peptide matches to query 1133
Elution from: 20.44 to 24.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1268215.4 FinneganScanNumber: 1086
Score greater than 29 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 19.0       1.7        6.09                    -.METALAKTPQK.R
 15.6       3.7         827                    R.TRPNMGAVRSK.G
 15.2         4       -0.38    1   IPI00301263 R.HPQPGAVELAAK.H
 12.8         7         809                    K.HPKKPEPQQK.A
 11.4       9.5         824                    -.MVAPWRVSVR.V
 10.7        11         809                    K.SPAVLHLQHSK.G
 10.5        12         840                    R.SPITSLTPGESK.T
  9.3        15         818                    R.SFVQVPXPSTR.T
  9.2        16       -3.18                    R.GKVMEVVGGAVR.V
  8.6        18       -0.38                    K.RFEEGVGKPAK.Q
Top scoring peptide matches to query 1134
Elution from: 20.53 to 24.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1268215.4 FinneganScanNumber: 1096
Score greater than 32 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 20.0       1.3         827                    R.TRPNMGAVRSK.G
 18.1         2        12.2                    K.EKPESRKESK.N
 14.4       4.8       -8.51                    K.VKDANLTLESK.L
 12.9       6.7         819                    K.LLEEDGTIITL.-
 11.3       9.9         809                    K.SPAVLHLQHSK.G
 11.2       9.9       -3.15                    K.VAAVEMLKGQR.A
 11.2        10        8.86                    R.LEHLFESKSK.E
 10.2        13         831                    R.LQKDGLTQADK.D
  9.6        14      -17.74                    K.KENLSKGGAVSK.L
  9.4        15       -0.38    1   IPI00301263 R.HPQPGAVELAAK.H
Top scoring peptide matches to query 1135
Elution from: 20.42 to 24.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1268215.4 FinneganScanNumber: 1084
Score greater than 29 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 20.5       1.2       -0.38    1   IPI00301263 R.HPQPGAVELAAK.H
 15.1       4.1      -11.82                    K.AYTLPVLPSEK.D
 14.7       4.5         810                    K.DTEIQLLKEK.L
 13.6       5.7      -17.75                    R.RKSTDSVPISK.S
 12.5       7.4        12.2                    K.EKPESRKESK.N
 12.2       7.9         827                    R.TRPNMGAVRSK.G
 10.9        11         810                    R.NILLSESDVVK.I
 10.6        12        1.84                    R.KHQRNHAAGAK.T
 10.3        12         822                    R.NSKINAENKAK.I
 10.2        13         818                    R.SFVQVPXPSTR.T
Top scoring peptide matches to query 1136
Elution from: 36.75 to 40.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 84612417.5 FinneganScanNumber: 2720
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       4.5         815        K.KRYDLSALVR.H
  1.9        41      -12.82        R.LLGTLHSPALLS.-
Top scoring peptide matches to query 1137
Elution from: 36.67 to 40.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 84612417.5 FinneganScanNumber: 2703
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1138
Elution from: 36.61 to 40.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 84564275.4 FinneganScanNumber: 2696
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.3        60         824        R.DLLYIGKDRK.N
Top scoring peptide matches to query 1139
Elution from: 36.61 to 40.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 84564275.4 FinneganScanNumber: 2695
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1140
Elution from: 36.81 to 40.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3823893.5 FinneganScanNumber: 2730
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        14       -7.23        R.LFKAMKGLGTR.D
  6.3        15       -1.17        R.HSLLRKPQDK.K
  5.4        19        17.2        K.DLIKPHEELK.K
  5.3        19        17.2        K.LSFISEREIK.S
  5.0        20        17.2        K.RLDYITAEIK.R
  4.8        21         836        K.MIKKEMTALR.R
  4.0        26       -7.23        K.IHNLIPVMLR.H
  3.6        28         806        R.VNARLQVPPAR.T
  2.7        34         832        R.VGIIAWHPTAR.N
  1.9        41        4.74        K.WYNSIGKLLK.E
Top scoring peptide matches to query 1141
Elution from: 37.05 to 41.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3823893.5 FinneganScanNumber: 2771
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.7       5.5         832        K.HKVLWDPVAR.R
  9.3       7.4        8.02        K.IVSPGLTIHER.I
  7.7        11         824        K.VVDKIAEYKR.Q
  6.3        15       -1.17        R.TAPTAALPPRAR.C
  6.0        16         836        K.MIKKEMTALR.R
  4.7        22         835        R.AVDTIRRAYR.N
  4.7        22         826        R.VRGQLNLHQR.I
  4.1        25        8.01        R.VEVQIGGPGPLR.W
  3.8        27         841        R.RMHHLKINR.E
  3.3        30        4.72        K.VSLPLFDFKR.F
Top scoring peptide matches to query 1142
Elution from: 39.63 to 43.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10550297.6 FinneganScanNumber: 3053
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.0       8.1        17.4        R.VPSAGGPPVLAEK.A
  4.0        26         824        R.NLLSETIFKR.D
  3.2        30         806        R.LLRLPTSQHR.L
  2.4        37        19.6        K.GXLLHTNTPGR.W
  1.5        46       -7.10        K.IHNLIPVMLR.H
  0.2        61        10.4        R.TPRPDRPRAR.D
Top scoring peptide matches to query 1143
Elution from: 39.63 to 43.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10550297.6 FinneganScanNumber: 3054
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.2        39        14.6        K.SGKMGSLALLTK.L
  0.5        57         836        K.KNLXPQQTHR.G
Top scoring peptide matches to query 1144
Elution from: 26.64 to 30.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 325023.9 FinneganScanNumber: 1675
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 26.9      0.26       -0.38   15+  IPI00019502 R.AGVLAHLEEER.D
  8.8        17         829                    K.FATLEMNPKR.A
  8.0        20       -1.48                    R.LRAAGAEGHWR.R
  8.0        20       -1.49                    R.RFHLTEHQR.I
  7.6        22         831                    -.MVCRLICVR.F
  7.4        23         814                    ELKQDISSFR
  5.6        35         841                    K.IQITMGSTEAR.V
  5.0        39      -15.62                    K.GIDYVKNKMR.E
  5.0        40         802                    R.ILNKGPDYFR.R
  4.7        43         820                    R.GPAHCLLLGER.V
Top scoring peptide matches to query 1145
Elution from: 26.66 to 30.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 168357.0 FinneganScanNumber: 1678
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 39.7     0.012         820   15+  IPI00019502 R.AGVLAHLEEER.D
 10.8         9        15.3                    K.SFVVSAASATER.Q
  9.5        12         820                    K.LLQHGINADDK.R
  8.6        15         825                    K.AMTKARNFER.V
  8.4        15         805                    K.LKAAYMNKER.A
  6.7        23         819                    R.LRAAGAEGHWR.R
  6.4        25        6.10                    R.LIESAHDNGLR.M
  6.3        25         811                    R.RSPPPSPTTQR.R
  5.9        28      -13.36                    R.SHHHRRAAPR.E
  5.7        29        8.14                    K.QPWHKMELR.E
Top scoring peptide matches to query 1146
Elution from: 30.29 to 34.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1129792.0 FinneganScanNumber: 1972
Score greater than 27 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 32.8      0.05       -0.53    1   IPI00301263 K.ATGYPLAYVAAK.L
 12.3       5.6         834                    R.LDGNAIFFQAK.G
 11.8       6.3         831                    K.LGDFGCSVKLK.N
 10.5       8.4        17.3                    K.SLYLZMBSLR.T
  9.2        11         819                    R.LGHQKREAER.Y
  6.8        20        14.1                    R.GIGGHDNISARK.F
  6.5        21         828                    K.IIEGGAAHKDGR.L
  5.5        27         825                    K.ARYIGGGPSAFK.L
  5.1        29         828                    R.AGDGHGSLQLLR.R
  4.9        31        14.1                    R.NHETRPGSKAK.G
Top scoring peptide matches to query 1147
Elution from: 30.29 to 34.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1129792.0 FinneganScanNumber: 1971
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 36.1     0.023       -0.53    1   IPI00301263 K.ATGYPLAYVAAK.L
 10.7         8      -12.45                    -.MAQKKYLQAK.L
 10.0       9.4      -12.47                    K.AGPPASIVPLMR.Q
  7.2        18       -6.42                    K.KVATPPNQNQK.Q
  6.5        21         804                    R.FLLLESQAFR.C
  6.1        23        14.1                    R.NHETRPGSKAK.G
  5.1        29        2.74                    K.ASSFSGISVLTR.G
  5.1        29         834                    R.LDGNAIFFQAK.G
  4.6        33       -6.41                    R.VAAAETAKHQAK.C
  4.5        33      -12.47                    K.HVQLVMEAIGK.L
Top scoring peptide matches to query 1148
Elution from: 27.60 to 31.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1066942.4 FinneganScanNumber: 1761
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 28.1      0.15       -9.11        K.LEAARAAEQLR.A
 18.2       1.5         803        K.LAKAGKNQGDPK.K
 17.6       1.7      -18.29        K.ENAKGQGLVRR.L
 17.0         2        9.19        K.LATELPDAELR.R
 15.9       2.6        14.5        -.MGAPLEVLQNR.V
 14.5       3.5       -3.26        K.SLQITYSLFR.R
 13.3       4.6         823        K.SLSQKENRHK.E
 13.2       4.7         817        K.HDVIMKSQLR.H
 13.2       4.8      -12.41        K.IANFVEHKAAK.L
 12.9       5.1        0.01        K.ATLTPSNTPLGR.N
Top scoring peptide matches to query 1149
Elution from: 27.60 to 31.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1066942.4 FinneganScanNumber: 1763
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 23.9       0.4       -9.11        K.LEAARAAEQLR.A
 21.2      0.75         812        R.LDSPATPEKIR.N
 20.7      0.83        9.19        K.LATELPDAELR.R
 17.6       1.7        0.02        R.QLAIIGDDINR.R
 17.3       1.8         803        K.LAKAGKNQGDPK.K
 16.7       2.1      -18.28        R.QERLRGEALR.T
 16.6       2.2         828        R.HPHVWGPGALR.V
 16.2       2.4        0.03        K.AGAVAEEALGAIR.T
 15.5       2.8         817        K.HDVIMKSQLR.H
 15.2         3        0.01        K.SSIPSPIGGSLGR.G
Top scoring peptide matches to query 1150
Elution from: 18.07 to 22.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 551699.3 FinneganScanNumber: 932
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        12         804        R.GTGRGGGGGGGGGAPR.G
  5.5        16        14.2        K.DMEPNGPSLPR.D
  3.3        26         837        R.GHCPPSTAASSR.S
  0.6        49        11.1        K.NDQNTSVSHAR.T
  0.5        50         808        K.LNEDSDFIFK.R
  0.1        55      -15.44        K.VMEGHGEVNIK.H
Top scoring peptide matches to query 1151
Elution from: 36.75 to 40.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2645413.5 FinneganScanNumber: 2717
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 86.2   1.9e-07       -1.64    1   IPI00301263 K.TLGVDLVALATR.V
 23.1      0.39         826                    -.MQLAARIRPR.D
 17.8       1.3         830                    R.VDRLIVDELR.E
 16.3       1.9       -1.61                    R.TLLIDGRAELK.R
 15.9       2.1      -10.75                    R.RQSIINELKK.A
 15.4       2.3        15.6                    K.FQIPQEVLVR.F
 14.2       3.1       -1.64                    R.DSVTKLVPLTR.R
 14.1       3.1         801                    K.EQLRAEILKK.R
 13.3       3.7      -10.76                    K.LKQQQAAVSKK.V
 13.2       3.8      -10.75                    K.EKINLIKSQR.W
Top scoring peptide matches to query 1152
Elution from: 36.72 to 40.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2645413.5 FinneganScanNumber: 2711
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 83.8   3.4e-07       -1.64    1   IPI00301263 K.TLGVDLVALATR.V
 18.2       1.2         830                    R.VDRLIVDELR.E
 16.0         2         821                    R.SQILRTPSLGR.E
 15.4       2.3      -10.76                    K.LKQQQAAVSKK.V
 13.9       3.3         821                    R.RGDLAALLSGVR.Q
 13.6       3.5         821                    K.VDRGPVRTVTK.R
 13.5       3.5        7.54                    R.KELDILLQEK.I
 13.2       3.9         821                    K.VLRQEVGVATR.A
 13.0         4         826                    -.MQLAARIRPR.D
 11.8       5.3         801                    K.EQLRAEILKK.R
Top scoring peptide matches to query 1153
Elution from: 36.67 to 40.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2645413.5 FinneganScanNumber: 2707
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 25.6      0.22       -1.64    1   IPI00301263 K.TLGVDLVALATR.V
  9.8       8.4         821                    K.VDRGPVRTVTK.R
  8.1        12        7.53                    K.KEIDVISIPSK.C
  7.8        13         827                    R.KEIQPPYKPK.A
  7.3        15         810                    K.LQELIKEVQK.Y
  7.1        16         830                    R.VDRLIVDELR.E
  7.1        16       -2.70                    R.LHPLHKREAK.E
  6.4        18         821                    R.RPTLQSLREK.G
  6.3        19        15.6                    K.IIQIDGQKKW.-
  5.4        23        7.52                    K.TALALEVGDIVK.V
Top scoring peptide matches to query 1154
Elution from: 20.91 to 24.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 832634.8 FinneganScanNumber: 1129
Score greater than 21 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9        11      -18.45        K.ENASEGKGPGKR.R
  7.5        15      -10.41        K.WGLNGEGQRGR.M
  7.0        17        5.14        R.SMQQLDPSPAR.K
  6.1        21       -9.30        K.ENINVLDQER.R
  5.8        22         824        R.DYFLSDFPPK.I
  5.8        22         836        -.MPAATVDHSQR.I
  5.4        24         807        -.MEPRTGGAANPK.G
  5.0        27        5.13        R.KVSGTMYNTGR.H
  4.6        29       -7.28        -.MDPLPYHKGR.R
  2.2        51         798        K.TADGFAVPEPPK.R
Top scoring peptide matches to query 1155
Elution from: 20.97 to 24.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 832634.8 FinneganScanNumber: 1134
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.2       3.2        5.13        R.KVSGTMYNTGR.H
  8.9        11       -9.30        K.DLEDLLQNNR.R
  8.8        11      -15.34        K.ETQTPVMAQPK.E
  8.1        13        10.5        M.RRFMETMSR.S
  7.8        14       -0.87        YGQTKKMMDK
  7.3        16      -18.45        K.ENASEGKGPGKR.R
  7.0        17         809        K.VQEFEHINGR.W
  6.5        19        17.0        K.SFESFLQESR.Q
  6.1        21        13.6        R.MKVFVCCASK.D
  6.0        21         807        R.GAGPAGMAEPRAK.A
Top scoring peptide matches to query 1156
Elution from: 36.01 to 40.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4474719.4 FinneganScanNumber: 2592
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.7       3.4         830        -.MQGHFPAERR.E
 14.5       3.5         798        K.EEQRPRTANK.A
 12.7       5.4       -1.07        R.WSSNLARHMK.N
 12.2       6.1         819        M.SNGGAGAGRSPAAR.Q
 10.9       8.1         831        R.NMIEEHSQLK.K
 10.8       8.4      -14.44        K.EQEVNELLQK.F
 10.0        10      -18.27        K.EVKPGMERGAR.R
  9.8        10         802        R.MHLLEETTVR.T
  9.3        12       -9.15        K.AVMSNLSAHGVK.L
  8.9        13         804        EEHAEFVLVR
Top scoring peptide matches to query 1157
Elution from: 36.68 to 40.67 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 25791626.1 FinneganScanNumber: 2709
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.4       4.5        12.2        R.CLPAGRLPAKR.K
  3.5        18         815        -.MDLIKVLYVK.K
  2.4        23         812        R.KSDGIHIINLK.R
Top scoring peptide matches to query 1158
Elution from: 36.72 to 40.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 25797926.3 FinneganScanNumber: 2713
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.6        11         823        R.IHARKLSEQR.K
  4.7        13        12.2        R.GMLHALVRIGR.E
  1.7        26        6.92        K.VEIQKHATGKK.S
  1.0        31       -2.16        R.SLILSSRHGIR.R
  0.3        37         808        K.LPHLQFLELK.R
  0.1        39         821        R.YTLKTVTVQGK.T
Top scoring peptide matches to query 1159
Elution from: 36.76 to 40.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 25797926.3 FinneganScanNumber: 2723
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.2        12         799        K.LLVWQKSVHK.L
  2.9        20         823        M.GKLQSKHAAAAR.K
  2.5        22         812        R.RVLPPSALQSVA.-
  2.3        23        12.2        R.GMLHALVRIGR.E
  2.3        24       -2.16        R.GPQVIAGGRQKK.G
  1.9        25         826        R.LGVFTRSMAKK.T
  1.9        26      -14.48        R.HILNFLRLGR.L
  1.8        26        6.91        R.GLLPSVLQQQR.Q
  1.5        28         793        K.KGPNQGRLVLR.L
  1.4        29       -8.11        MNKHVLKIQK
Top scoring peptide matches to query 1160
Elution from: 37.05 to 41.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 25791626.1 FinneganScanNumber: 2773
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.6       8.6         799        K.LLVWQKSVHK.L
  3.4        18        10.0        -.MAVLPVPLPSAK.M
  2.4        23         826        K.FRTLAKTCIK.K
  2.4        23        6.94        R.GLLPSVLQQQR.Q
  2.1        24      -13.38        K.HTVLVTELKAK.L
  2.1        24      -13.37        R.HISVLAETIKK.G
  1.8        26         823        M.GKLQSKHAAAAR.K
  1.3        29         812        K.EKQVKELVHK.G
  1.0        31       -4.29        K.SLPSSLIPPISK.Y
Top scoring peptide matches to query 1161
Elution from: 22.50 to 26.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1248997.0 FinneganScanNumber: 1277
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 17.8       1.6       -8.79                    R.ENGGGGDGRALLK.Q
 16.1       2.3         802    9   IPI00029446 R.LETELGQPAER.W
 15.1         3        9.29                    K.ESSGQSVVPEPK.D
 14.3       3.6         827                    R.GPSPCSSPARAR.R
 14.1       3.8        14.5                    K.GRLMPGQDPEK.T
 11.9       6.3      -19.99                    R.EAVKTLGGDPEK.V
  9.1        12      -19.96                    R.ALEAANGELEVK.I
  7.5        17        8.21                    K.NNFPASVHTTR.Y
  7.2        18         793                    K.SRGADNPVADLK.K
  6.8        20      -19.98                    K.KVEAPETNIDK.T
Top scoring peptide matches to query 1162
Elution from: 22.55 to 26.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1248997.0 FinneganScanNumber: 1282
Score greater than 29 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 16.1       2.3         816                    K.SSFSKIGCTGAK.C
 15.3       2.8        6.06                    K.LDFETQSLYK.L
 14.4       3.5         802    9   IPI00029446 R.LETELGQPAER.W
 13.9       3.9        8.21                    K.NNFPASVHTTR.Y
 13.5       4.3       -3.53                    -.MIAGSGTRAHAR.A
 13.1       4.7        6.07                    R.KLTFDEEAYK.N
 12.9       4.9         793                    K.KIQEHNTTGSK.L
 12.9         5      -19.98                    K.KVEAPETNIDK.T
 11.7       6.5      -19.99                    R.EAVKTLGGDPEK.V
 10.8       8.1        6.06                    K.IPGYDPEPVEK.L
Top scoring peptide matches to query 1163
Elution from: 37.12 to 41.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1197838.4 FinneganScanNumber: 2780
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.9       3.9         803        K.IVHILNMTSAK.I
  7.8        20         818        K.ASLPSIQEELR.H
  7.1        24        4.54        K.EERIFATHLK.A
  7.0        24         798        K.LEEVVQILGDK.F
  7.0        24        16.8        K.LDVSSNKAPANK.D
  6.9        25      -12.45        R.KLKENAGQDIK.L
  6.7        26      -12.45        K.NQLIVESAKNK.K
  5.5        34         800        K.AAEAKRLAEQR.E
  4.9        39       -3.42        K.VSSPLENEKLK.S
  4.8        40         824        K.LKKHQDSVCK.L
Top scoring peptide matches to query 1164
Elution from: 29.65 to 33.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3446446.1 FinneganScanNumber: 1935
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 69.9   7.5e-06       -0.26    2+  IPI00011654 R.ISEQFTAMFR.R
 34.7     0.025         818   25   IPI00218743 EAEAGESLEPGR
 22.3      0.43         794                    K.ISELDKCSHR.V
 20.5      0.65        13.6                    R.EAGAWNHGTFR.L
 14.3       2.7         789                    R.DTGETTTLPPGR.H
 12.1       4.6       -0.80                    K.HQRNLGMSMR.V
 10.7       6.2         789                    K.EAEDAPEKLSR.A
 10.6       6.4         800                    K.AQEEQERAQR.E
 10.2         7        17.2                    R.LCPVASCPDAR.L
  9.5       8.2      -11.28                    K.SLEQQLADADR.Q
Top scoring peptide matches to query 1165
Elution from: 29.60 to 33.57 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3446446.1 FinneganScanNumber: 1925
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 61.9   4.7e-05       -0.26    2+  IPI00011654 R.ISEQFTAMFR.R
 16.2       1.8        17.2                    R.LCPVASCPDAR.L
 15.5       2.1        13.6                    R.EAGAWNHGTFR.L
 11.5       5.1         818   25   IPI00218743 EAEAGESLEPGR
 10.0       7.3         789                    R.DTGETTTLPPGR.H
  9.8       7.6      -17.22                    K.EALHATMDLTK.E
  8.8       9.6         818                    R.AKDFISNMMR.N
  8.7        10       -0.80                    K.HQRNLGMSMR.V
  8.7        10      -11.28                    K.SLEQQLADADR.Q
  8.2        11         803                    R.AQEKVHEMEK.E
Top scoring peptide matches to query 1166
Elution from: 29.54 to 33.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3446446.1 FinneganScanNumber: 1920
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 71.0   5.9e-06       -0.26    2+  IPI00011654 R.ISEQFTAMFR.R
 19.8      0.77         818   25   IPI00218743 EAEAGESLEPGR
 19.3      0.87        13.6                    R.EAGAWNHGTFR.L
 14.0       2.9         803                    K.TEPLISPGCDR.I
 13.0       3.6         789                    R.DTGETTTLPPGR.H
 12.4       4.2         791                    R.MLDFRVEYR.D
 11.8       4.8        7.70                    M.EAWGLCAWPR.G
 11.6       5.1      -11.28                    K.SLEQQLADADR.Q
 10.4       6.7         794                    R.QQAAQPLGEXR.W
  9.0       9.2         806                    R.TEGGYYQITGR.M
Top scoring peptide matches to query 1167
Elution from: 34.85 to 38.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1040870.0 FinneganScanNumber: 2415
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.2       2.5       -8.67        K.IMDNGIQGELR.R
 13.1       5.1         821        K.IAKMEHGEADK.K
 11.5       7.4         794        K.APDGPQSGFQLK.Q
 11.4       7.5         792        K.TQMAEVLPSPR.G
 11.4       7.5         812        R.CAQPSLQSTPR.M
 10.8       8.7        5.58        K.SSKTMHPGCLK.S
 10.2       9.9         807        K.GSLVPSDGQAGEK.L
 10.2       9.9        0.35        K.EVMLQNGETPK.D
  8.2        16         800        R.TVCNLYRYR.N
  7.7        18         809        K.NFFSSNKCIK.I
Top scoring peptide matches to query 1168
Elution from: 33.94 to 37.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1103013.6 FinneganScanNumber: 2304
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 38.6     0.019         812   19   IPI00642952 R.EDIISDLRQR.R
 34.6     0.049         797   26   IPI00167180 R.MPEELARRVK.E
 22.0      0.88         792                    R.LSQDLEALLSR.M
 16.4       3.2        14.7                    K.NKMPSLSPIDK.N
 16.1       3.4         791                    K.FDQKPGLQRR.G
 14.9       4.5      -17.62                    R.SGTLVTAGRIDR.E
 14.1       5.4         806                    -.MPTVISASVAPR.T
 11.9       9.1         791                    K.IEVQPKTHHR.A
 11.5        10       -8.56                    K.LKVSEEEKQR.I
 11.3        10         788                    K.DIEINGVFIPK.G
Top scoring peptide matches to query 1169
Elution from: 40.36 to 44.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 663528.5 FinneganScanNumber: 3104
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1170
Elution from: 40.36 to 44.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 348182.1 FinneganScanNumber: 3105
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1171
Elution from: 38.24 to 42.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1792173.1 FinneganScanNumber: 2960
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.9        37         809        K.RQLAETKSSTK.S
Top scoring peptide matches to query 1172
Elution from: 37.92 to 41.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1792173.1 FinneganScanNumber: 2919
Score greater than 16 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.8        38        2.47        K.AAFKEPKMALK.E
  3.2        43        11.4        -.MDVLSPLSFIK.V
  2.5        51         806        EDLEKFKALR
  0.6        79        2.45        R.LMTPTLSFLAR.S
  0.4        82        14.7        -.MSLSNKLTLDK.L
  0.4        83       -0.59        R.ALLEKNRSYR.L
Top scoring peptide matches to query 1173
Elution from: 37.95 to 41.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1792173.1 FinneganScanNumber: 2924
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4        17         824        K.LGVSLTMARER.G
  5.3        27         809        R.RMMGNTVALKK.-
  4.2        34         817        R.AREAGGPQPIPR.E
  3.8        37         788        R.MMGVAKLTLLR.V
  3.8        38         788        R.MMGVAKLTLLR.V
  2.6        49         805        EILRPWHAAR
  2.4        52         788        R.RQVKGALGTYR.A
  2.3        53         786        K.ATIEDILFKAK.R
  2.0        57         797        K.NKELRQGLYK.V
  1.9        58         803        K.ELMELKTKTR.E
Top scoring peptide matches to query 1174
Elution from: 31.71 to 35.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 826053.0 FinneganScanNumber: 2111
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 38.6    0.0033       -0.09    1   IPI00301263 K.KNILLTIGSYK.N
 17.8       0.4         800                    R.QARLPPAGGLLR.R
  9.9       2.5        7.82                    K.KLLKQYGFPR.R
  8.1       3.8        5.14                    R.KILGYMQLRK.G
  7.8       4.1       -9.10                    R.ELVVPQLPARK.K
  6.3       5.7        11.1                    K.EVKQNIHLIR.A
  6.2       5.8         812                    K.DIKQMLLFLK.D
  3.4        11         818                    R.QTKPATKSFIK.G
  3.3        11         814                    K.NGALPLLLYFK.E
  3.1        12        7.81                    R.KFKTNVLPFR.Q
Top scoring peptide matches to query 1175
Elution from: 31.71 to 35.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 826053.0 FinneganScanNumber: 2109
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 37.0    0.0048       -0.09    1   IPI00301263 K.KNILLTIGSYK.N
 17.6      0.42        16.8                    R.VQVIFPPQPPK.-
 13.1       1.2       -9.11                    R.VKLQDGVHIIK.E
 11.1       1.9         814                    K.NGALPLLLYFK.E
 10.8         2         800                    R.QARLPPAGGLLR.R
  7.3       4.5         812                    R.LSAPVLVPMPPK.V
  6.8       5.1        11.1                    R.RAGAPLEIPVAR.L
  5.8       6.4        5.12                    K.VKLMKFSRPK.K
  4.8       8.1       -9.10                    R.ELVVPQLPARK.K
  4.3         9         789                    R.KLVVISDPHIK.I
Top scoring peptide matches to query 1176
Elution from: 35.23 to 39.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 515514.2 FinneganScanNumber: 2466
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.9       3.8        0.09        K.SFDALLDNLSR.K
 14.6         4       -3.31        -.MGNLGMIMVIR.I
 14.6       4.1      -14.83        R.YPVGVSNMVLR.I
 14.2       4.4         808        K.DYIARNXDLR.S
 13.7       4.9        5.30        K.KCPFTGNASIR.G
 13.7         5       -2.59        R.KKMETEAELR.K
 13.0       5.8         806        -.XESMLNATTRR.M
 12.1       7.2        7.99        K.GSGWQTFQALR.S
 11.7         8         785        -.MTGLLQKSDTR.G
 10.8       9.8         811        R.VIMGCRDRAR.A
Top scoring peptide matches to query 1177
Elution from: 25.49 to 29.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 525477.1 FinneganScanNumber: 1569
Score greater than 16 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2        11         812        K.GNLIGEMAADIM.-
  8.1        11         788        R.WQNMGTSVRR.R
  3.0        37         811        R.DPCNRKMWK.V
  2.9        38       -7.80        K.SEELRVMSER.V
  2.2        44       -2.06        K.TICDPEEFLK.S
Top scoring peptide matches to query 1178
Elution from: 25.55 to 29.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 525477.1 FinneganScanNumber: 1574
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.3        22        3.14        K.NHVMVMDFVK.S
  5.1        22         791        K.DLPSADSVQYR.H
  4.9        24         811        R.DPCNRKMWK.V
  4.7        25        6.39        R.MLDSLRDCNK.I
  2.5        41         789        K.DQQKLEMSGSK.E
  2.1        45       -6.18        K.RGNREWYDR.I
  0.5        65         802        K.WMKYGYTSSK.L
Top scoring peptide matches to query 1179
Elution from: 26.05 to 30.05 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2479176.4 FinneganScanNumber: 1621
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.4       4.8         805        K.DHSRILVGDSR.G
  8.4        15        14.5        -.MTIHVPLDASR.S
  8.1        17       -8.61        R.SPSLRTVDPQR.G
  7.8        18       -5.52        -.MPELAKSAPAPK.K
  6.5        24        5.56        R.TMKVYTRNSR.D
  6.5        24         814        M.SKSFQQSSLSR.D
  5.6        29        8.25        R.EPRNSLTWPR.Y
  5.6        29         808        K.STLMNILAGYR.E
  5.4        31         794        R.HSVATAADLELK.S
  5.4        31         791        K.IFEKNVYVDK.N
Top scoring peptide matches to query 1180
Elution from: 26.10 to 30.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2479176.4 FinneganScanNumber: 1625
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.8       4.4         785        R.ELKGHVISESR.S
 13.4       4.9        14.5        -.MTIHVPLDASR.S
 11.6       7.5         805        K.DHSRILVGDSR.G
 11.5       7.5         799        K.QLQKQVHMDK.K
 11.1       8.2         799        K.QEMLLKPHSR.V
  8.1        17         791        K.IFEKNVYVDK.N
  7.5        19        0.36        R.NESPPVSALVSR.T
  7.0        21         794        R.HSVATAADLELK.S
  6.9        22         784        K.QAGSKFHARPR.F
  6.5        24       -8.61        R.GGGSHTKTLIER.S
Top scoring peptide matches to query 1181
Elution from: 26.02 to 30.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2479176.4 FinneganScanNumber: 1619
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.4      0.76         805        K.DHSRILVGDSR.G
 13.3       4.9        5.55        K.TQHQMRVLDK.L
 10.6       9.4         784        R.VHGALQRFGGGR.N
  8.9        14         811        K.SGHQLLPQEVF.-
  8.0        17         802        R.QHSSSLPVFPR.A
  7.8        18         790        R.SHRNDIMLLR.L
  7.0        21       -3.39        R.KRPGGPEARCK.D
  6.9        22         790        K.RMIPPQNGVSR.K
  6.6        23         796        R.HQQRSTVTAAR.T
  6.2        26         785        R.ELKGHVISESR.S
Top scoring peptide matches to query 1182
Elution from: 37.16 to 41.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5194575.3 FinneganScanNumber: 2790
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2       7.2         801        R.LAVIARNLEGAK.A
  4.2        18      -12.96        K.EKLLQVEKLR.K
  3.9        19      -12.96        K.KLKELVGEAIR.R
  3.7        20        16.0        K.AIVETAAQLAIR.V
  3.3        22        16.0        R.DLKQLLQELR.S
  2.6        26         800        K.RGRLGGILAWR.G
  1.8        31         798        K.KEKVLLIQFH.-
  1.7        32         818        R.IPAYKAVSHLR.L
  1.7        32      -12.96        K.LQLLKDLERK.Y
Top scoring peptide matches to query 1183
Elution from: 36.81 to 40.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5194575.3 FinneganScanNumber: 2731
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8         5       -1.89        K.NRVVQSGIKVR.L
  9.4       5.5         809        R.LSWLQRKAPR.N
  9.1       5.9        7.07        K.LNIRQSVGIQK.V
  8.5       6.7         801        R.RDPTLLVSVVR.I
  7.2         9      -16.72        K.RAIRLGGIMLR.K
  5.7        13         810        R.DSLARIPLLEK.L
  4.2        18         792        R.ALNLGAATVLRR.H
  4.0        19      -12.97        R.VLLLAGSRADLK.N
  4.0        19        16.0        K.QVDVLGTVIGVR.E
  3.9        20       -5.09        R.LALRLGNFPVR.H
Top scoring peptide matches to query 1184
Elution from: 36.79 to 40.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5194575.3 FinneganScanNumber: 2726
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9       6.1         815        MNKHVLKIQK
  8.6       6.6         792        R.KVAQKLLNGQR.K
  8.1       7.3         801        R.GRPTPTLEKKK.K
  7.5       8.4      -12.96        R.VQLLKERLEK.F
  6.9       9.7         801        R.LLTQVGAQVLGR.L
  6.5        11         781        K.KVVKXASEGPLK.S
  3.7        20        7.09        R.AIIRDRAALEK.Q
  3.4        22         792        K.LRRNVNLLEK.L
  3.4        22         781        R.KILAQDVVQLK.E
  3.1        23       -1.89        R.RRLQQVGTVAK.L
Top scoring peptide matches to query 1185
Elution from: 37.12 to 41.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1611110.8 FinneganScanNumber: 2784
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.2        12         817        K.ITENSIVENLK.K
  5.6        28         799        R.KLERSEQLTR.E
  3.9        42         784        K.VARRLQVSLSM.-
  3.6        45         808        R.ESQLKERLEK.R
  3.3        48         796        K.DPGVLSFLRQK.E
  2.9        53         808        R.ESLQEELKRK.K
  1.3        76        11.3        R.IEQLKQTICK.G
  0.6        90         787        K.QPTIFQNKKR.V
  0.5        92         805        K.LESAWELGKVK.G
  0.3        96         802        -.MESVVPVKDKK.L
Top scoring peptide matches to query 1186
Elution from: 37.13 to 41.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1611110.8 FinneganScanNumber: 2785
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.2       2.4         813        K.MLRGSGLPAVSR.E
 11.0       8.1         816        K.FRQLESPNLR.Q
 10.4       9.3        8.21        K.DITSAVQSKRR.K
  9.5        11         813        K.QMKAQQLREK.L
  9.3        12        13.4        R.VCRSLSAVGRR.V
  8.1        16         801        K.MLGLFRKHNK.I
  7.0        21         808        K.ESQKLLEKER.L
  6.0        26         804        K.EAMVRALGRTR.L
  5.3        31         808        R.ENSTERVIAIK.V
  5.0        32      -17.61        K.KRMDLVLELK.N
Top scoring peptide matches to query 1187
Elution from: 37.13 to 41.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10081691.0 FinneganScanNumber: 2785
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.4        11         790        K.DITSAVQSKRR.K
  9.4        15        14.5        R.NRRVMDVISR.S
  9.3        15         796        R.VCRSLSAVGRR.V
  7.3        23        12.3        K.LPMIPSSSASKK.K
  5.8        33        14.5        K.REGLRLGAMSR.Q
  5.7        34         816        K.TYDKTVALGHR.L
  5.4        36         808        R.KVMKTIEHMK.M
  4.7        43         807        K.LWRKASSQER.A
  4.5        45         808        K.EKEILESREK.Q
  4.4        46         808        R.KSLSALASSPDGK.Y
Top scoring peptide matches to query 1188
Elution from: 38.17 to 42.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2524920.7 FinneganScanNumber: 2953
Score greater than 26 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.4      0.73         802        R.REAVGVLVAPPR.V
 12.8       1.3         811        K.LLGVGTKYLGSR.I
  4.9       8.2         809        M.PVLSRPRPWR.G
  4.6       8.8         813        R.KPRAAVGSGHRK.Q
  3.7        11        19.2        R.KESPLLFKFR.A
  3.3        12        19.2        R.AFIPPAPVLPSR.D
  3.0        13         811        R.LQVVDQPLPVR.G
  3.0        13         813        K.RQRINPLPGGR.N
  3.0        13         782        K.SALTVKFLTKR.F
  2.3        15        19.2        R.VWALELLPAPR.T
Top scoring peptide matches to query 1189
Elution from: 27.50 to 31.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3182558.0 FinneganScanNumber: 1753
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 54.9    0.0004        0.11    7   IPI00220327 R.TNAENEFVTIK.K
 27.1      0.24      -17.66                    K.QSAKDHIVDPR.D
 18.1       1.9        3.29                    R.QSSLSSGLSGGASK.G
 17.0       2.4         814                    R.VLGESGEMDALK.I
 14.8         4         779                    K.DVAQGILSYGNK.K
 13.0       6.2         779                    R.QSLEYDLAVAR.K
 12.5       6.8       -8.75                    K.YVGESEANIRK.L
 10.9       9.9        5.27                    K.CLVFSENAGIR.C
 10.2        12       -2.55   15   IPI00019502 K.LQEMEGTVKSK.Y
 10.2        12        11.1                    K.ETGKENFRER.G
Top scoring peptide matches to query 1190
Elution from: 27.45 to 31.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3182558.0 FinneganScanNumber: 1746
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 44.6    0.0042        0.11    7   IPI00220327 R.TNAENEFVTIK.K
 17.4       2.2      -11.43                    R.SKMAIQTQQSK.F
 15.4       3.5        3.29                    R.QSSLSSGLSGGASK.G
 13.5       5.4         776                    M.ASQKQMEVVTK.G
 13.2       5.9      -17.66                    K.QSAKDHIVDPR.D
 12.9       6.2        12.2                    K.TNESSLSAKSEL.-
 11.8         8      -11.42                    R.SECSAALGKKSK.R
  9.8        13        3.30                    R.QASETGSDSKKK.Y
  9.2        15       -2.55   15   IPI00019502 K.LQEMEGTVKSK.Y
  8.8        16         785                    R.TALEKEIMEGK.R
Top scoring peptide matches to query 1191
Elution from: 27.47 to 31.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3182558.0 FinneganScanNumber: 1750
Score greater than 32 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 52.4    0.0007        0.11    7   IPI00220327 R.TNAENEFVTIK.K
 15.8       3.2        3.29                    R.QSSLSSGLSGGASK.G
 13.0       6.1       -8.75                    K.QERLYVNSEK.Q
 12.3       7.2         779                    R.FIEELRTNDK.W
 12.0       7.6      -11.43                    R.SKMAIQTQQSK.F
 11.9       7.8      -19.77                    K.LYEISVEAVDK.G
 10.9       9.9         790                    R.KVLGNQMMSEK.K
 10.7        10       -2.54                    K.ETETLMEKLR.K
 10.5        11        14.2                    K.AECTKIWTEK.I
  9.8        13      -17.66                    K.QSAKDHIVDPR.D
Top scoring peptide matches to query 1192
Elution from: 36.94 to 40.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 50398112.5 FinneganScanNumber: 2754
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.9        25        18.4        R.DRGPRLLGEPR.W
  3.9        25        1.58        K.ELKLLFSMLR.G
  0.8        51         786        K.KGVSSGKGYILR.N
Top scoring peptide matches to query 1193
Elution from: 36.85 to 40.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 50398112.5 FinneganScanNumber: 2739
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2         9        18.4        K.ASAPAAPRQGLAR.S
  2.9        31         812        R.LFLQFVTGSPR.L
  2.5        34         780        K.LLSKFEMIKR.S
  1.7        41         786        K.KGVSSGKGYILR.N
Top scoring peptide matches to query 1194
Elution from: 36.81 to 40.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 50398112.5 FinneganScanNumber: 2729
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.2        14       -1.49        R.VALPGVDVSRPR.L
  5.2        18        1.58        K.ELKLLFSMLR.G
  3.5        27         777        R.GLLARLPGGASPR.A
  2.1        37      -19.23        R.QHRTRVLSIR.N
  0.1        59         800        K.KLFAQRMVQK.A
Top scoring peptide matches to query 1195
Elution from: 36.81 to 40.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 50398112.5 FinneganScanNumber: 2732
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.5        27         797        K.AVRQGHLSLQR.I
  2.7        32        16.3        R.IVASASFDKSIK.L
  1.9        39         795        R.SHLSISPVSLPK.H
  0.5        54       -7.30        R.KILGYMQLRK.G
  0.3        56         812        R.LFLQFVTGSPR.L
Top scoring peptide matches to query 1196
Elution from: 37.19 to 41.20 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6197713.6 FinneganScanNumber: 2798
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.9        19        9.97        R.RQAPAGSPRGLR.K
  3.0        30         798        NKGGVAVKAHQR
  2.1        37         803        K.YHTVPLPPKGR.V
  1.1        46       -1.03        K.SEPQPIIIGRR.N
Top scoring peptide matches to query 1197
Elution from: 37.05 to 41.02 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6197713.6 FinneganScanNumber: 2767
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.8        20         798        NKGGVAVKAHQR
  1.4        44         783        R.VWALELLPAPR.T
Top scoring peptide matches to query 1198
Elution from: 36.94 to 40.96 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6197713.6 FinneganScanNumber: 2755
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4        11         790        -.MSFLLPKLTSK.K
  3.4        28       -6.89        K.SMQLLFKRVK.S
  1.8        40         778        K.GRLPVPKEVNR.K
Top scoring peptide matches to query 1199
Elution from: 25.16 to 29.15 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 471471.1 FinneganScanNumber: 1544
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 48.6    0.0013        2.10    6   IPI00011569 K.VEVGTEVTDYR.F
 17.2       1.7      -15.64                    R.GAALGTGPAGEGPGR.W
 12.3       5.4      -15.62                    K.LDQPGNLPGSNR.R
  7.8        15         780                    R.EVVNTELGSYR.D
  6.6        20       -1.61                    R.ICGVDRTQYR.A
  6.4        21      -15.61                    R.SLEQQLQEHR.L
  5.5        26         776                    K.QVCSRLGQYR.M
  5.5        26      -10.47                    R.RRAAVDTYCR.H
  5.4        26       -6.76                    R.VQVTSQEYSAR.L
  5.2        28         774                    R.EVKEMEQFVK.K
Top scoring peptide matches to query 1200
Elution from: 25.14 to 29.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 471471.1 FinneganScanNumber: 1541
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 39.9    0.0094        2.10    6   IPI00011569 K.VEVGTEVTDYR.F
 14.8       3.1      -15.62                    K.LDQPGNLPGSNR.R
  8.9        12        2.10                    R.EVTTEFTVDAR.S
  8.2        14         774                    R.EVKEMEQFVK.K
  7.9        15        13.5                    K.DLTCMVKEQK.T
  7.6        16         774                    R.LGAKDDFMEIK.S
  6.6        20        18.8                    K.NLQSAEEWYK.S
  6.5        21        2.12                    K.LDNYSTQELGK.T
  6.3        22         800                    K.NTMALMDLDVK.K
  6.1        22        10.4                    K.CDSNVSSSKKR.R
Top scoring peptide matches to query 1201
Elution from: 27.41 to 31.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 398298.6 FinneganScanNumber: 1743
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.0       7.6        14.0        -.MAEVVSPVPGAGR.R
  7.2        18         782        R.LFASFSGADLLK.M
  6.6        21         811        K.VIGAGEFGEVYK.G
  6.0        24         790        R.GSPVCRPGPTLK.G
  5.6        26         776        K.QSVPGGGSKVPQK.Q
  5.5        27      -19.74        K.NILPGKELEEK.I
  5.3        28        14.0        R.VPIPVDRSCGGL.-
  5.2        29         804        K.NMFKTCRLAK.E
  5.1        29         811        R.TGKMLMSKMNK.S
  5.1        30         796        K.IPRGGTATPGEGR.T
Top scoring peptide matches to query 1202
Elution from: 37.30 to 41.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 2815
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1203
Elution from: 38.02 to 42.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 294681.9 FinneganScanNumber: 2936
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.4       2.8         795        K.STTEYAASVKGR.F
 10.1       9.5        1.57        K.APSVSRGSQEPR.S
  9.3        11         771        R.NMGKPAQPALSR.E
  6.3        23         795        K.SPSPSPTSPGSLR.K
  6.2        24         780        R.HGLMLVGPTGSGK.S
  5.4        28         780        -.MLGTPTQVPGPR.H
  5.0        31         786        K.AAEESERPKPR.S
  4.5        34        1.42        K.DVLMVSHPLPY.-
  3.8        41         806        R.SLQTICSWFK.H
  0.5        87         803        K.LVMFVQTEMR.G
Top scoring peptide matches to query 1204
Elution from: 36.76 to 40.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 460135.3 FinneganScanNumber: 2724
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.5       1.8        19.0        K.LGSGPSIKALDGR.S
  5.5        22         791        K.GGLLQVGPPLXR.A
  3.9        32         808        R.FILSFLHAHGK.L
  3.8        32        10.2        R.QKRLQEALER.Q
  3.8        33       -9.64        R.NALILQSAANKK.Q
  2.4        46         795        R.VGGTGGAASKLVPR.S
  0.7        67       -0.81        K.VPEEKAAKVATK.I
  0.6        68        19.0        -.XTLQTAAQATLR.Q
  0.3        73         775        R.VTSLANLISPVR.N
  0.3        73      -18.53        R.LKAGDTVGVVRR.E
Top scoring peptide matches to query 1205
Elution from: 18.55 to 22.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 145809.0 FinneganScanNumber: 963
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.0       2.6      -12.29        R.DNFMQQKAFK.Y
 10.8       4.3      -15.47        MPFFGNTFSPK
  2.3        30        7.49        R.HHNVYCSLDK.S
  2.1        32      -12.29        K.EIFGGNXKCGK.K
  1.9        33      -12.31        R.VDCGYPHVTPK.E
  1.7        35        5.53        K.DNPLNEGTDAAR.A
  1.7        35        14.4        R.EDENAEAEIPR.S
  0.9        42        11.2        K.DEDKFFSQEK.Y
  0.5        46      -18.11        R.MIFAATFCAPK.A
  0.4        47         806        K.IMPASTFDMDK.L
Top scoring peptide matches to query 1206
Elution from: 18.53 to 22.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 906502.0 FinneganScanNumber: 960
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       3.6         785        R.GESTRPHNMAR.T
 10.3       4.9      -14.02        R.QDLEPSVEEAR.Y
  9.2       6.3      -12.05        SCYPYIISNR
  7.9       8.4       -9.96        R.SCQRFGQXPR.V
  6.8        11         798        K.DDENPVPDSVGK.W
  6.7        11       -9.57        -.MMEMGFRAKR.S
  5.6        14       -3.24        K.KQTDMFEFQV.-
  5.3        15       -3.07        R.AEAREAPGGGSDR.D
  5.0        16         791        K.LSSQGRPGFYC.-
  4.9        17       -8.52        K.ISTGMMMKETK.E
Top scoring peptide matches to query 1207
Elution from: 18.55 to 22.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 906502.0 FinneganScanNumber: 962
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.9       3.4       -8.52        K.ISTGMMMKETK.E
 11.4       3.7         806        R.DEESFFGERR.I
 10.8       4.4      -14.02        R.QDLEPSVEEAR.Y
  9.3       6.1       -8.52        K.ISTGMMMKETK.E
  7.7       8.8       -8.52        K.ISTGMMMKETK.E
  6.7        11         798        K.DDENPVPDSVGK.W
  5.8        14       -1.12        M.ENTGWMGKGHR.M
  5.5        15       -0.75        K.ALKFMCSMPR.S
  4.8        17      -12.09        R.VDCGYPHVTPK.E
  4.7        18         788        R.VMQEACAKYR.A
Top scoring peptide matches to query 1208
Elution from: 25.03 to 29.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 514676.7 FinneganScanNumber: 1526
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 30.4     0.078        9.43        K.EELEEIASEPK.S
 18.9       1.1       -8.24        K.QDDQIERLEK.I
 17.2       1.6         770        R.GANFHFQPVQK.A
 16.7       1.8       -8.24        K.LQGAGEEEAKGGK.R
 16.5         2       -8.25        R.SPDSGTSAQAKPK.E
 14.7         3      -14.07        R.DLAVAGPEMQVK.L
 12.4         5       -3.12        -.MPEPRGSSQLR.V
 11.5       6.1         797        -.MLDVEAQEPPK.G
 11.4       6.3        0.57        K.SITADGESPPATK.I
 10.9       7.1      -17.05        K.IEEARSQANQK.A
Top scoring peptide matches to query 1209
Elution from: 24.95 to 28.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 514676.7 FinneganScanNumber: 1517
Score greater than 29 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.6       1.2       -6.14        R.DNKASGGRAAGGGR.A
 15.0       2.7        0.57        K.SITADGESPPATK.I
 14.1       3.4       -3.12        -.MPEPRGSSQLR.V
 12.0       5.5        9.43        K.EELEEIASEPK.S
 11.9       5.6        11.5        R.SLGNQPSSEAAGR.S
 11.6         6       -8.91        R.MELMHAEKLR.K
 10.3       8.1       -6.12        K.QNEEARRTNR.Q
  9.4       9.9         783        K.DGSPIADDLLEK.L
  9.2        10      -17.06        R.ELERVEQQSR.L
  7.6        15       -6.15        K.SGGPSGRGTERGR.R
Top scoring peptide matches to query 1210
Elution from: 36.85 to 40.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16000320.2 FinneganScanNumber: 2736
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.1       9.6         792        R.GSGKVPWLKPGR.S
  5.1        12         777        R.VLRGRPGAGSRR.R
  4.0        16         786        R.LISRNPGRAAAR.A
  3.4        18         801        R.WPPLSLVGAVSR.S
  2.4        22         765        K.ALSLLNIPLEAK.G
  0.1        38         798        R.CAVKPVELLPR.A
Top scoring peptide matches to query 1211
Elution from: 37.00 to 41.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16000320.2 FinneganScanNumber: 2763
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.1      0.48         775        M.TTPALLPLSGRR.I
 17.6      0.67         775        K.EITSAIKRVHK.F
  7.0       7.8      -12.54        R.DIIKGPISAQLK.S
  5.3        12        15.8        K.RGLVPVDALTEI.-
  5.0        12        14.8        M.WLAAAAPSLARR.L
  1.9        25         774        R.RAPPPRVXPVR.L
  1.5        28       -4.81        K.SFIRLSYLKR.H
  1.3        29         772        -.XKHLLSELKK.I
  1.1        30        1.33        K.KLHISMLALEK.E
  1.1        31         801        R.WPPLSLVGAVSR.S
Top scoring peptide matches to query 1212
Elution from: 36.89 to 40.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16000320.2 FinneganScanNumber: 2745
Score greater than 18 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.7       5.3         775        M.TTPALLPLSGRR.I
  4.9        13         778        K.GLRSRPARAAAR.A
  4.2        15         795        K.KIQVEQPQRR.F
  4.1        15         775        K.VPVEAKINQKR.E
  0.6        34         774        R.RAPPPRVXPVR.L
Top scoring peptide matches to query 1213
Elution from: 37.30 to 41.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16000320.2 FinneganScanNumber: 2814
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5       8.6         786        R.RARSAPAAAIAAR.V
  2.9        20        15.9        K.RGLVPVDALTEI.-
  2.6        22         775        K.VPVEAKINQKR.E
  1.9        25         792        R.AGREFHKPLVK.E
  1.6        27      -12.51        K.ETLTLLIQVPR.I
  1.6        27       -1.64        TILRIPSAQQR
  0.6        34        18.0        M.DALLGTGPRRAR.G
  0.6        34        15.9        R.VSIAAQLLQDPK.V
  0.6        34        7.11        R.KPVDSVPLSRGK.E
  0.5        35      -12.51        K.GQDLTPAKLLVK.I
Top scoring peptide matches to query 1214
Elution from: 37.92 to 41.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 31625133.4 FinneganScanNumber: 2917
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 29.4     0.094        0.49   13   IPI00003421 K.LSPVLDGVSELR.H
 23.1       0.4       -0.53                    R.APASAAWRSVLR.V
 21.6      0.56      -16.98                    R.RLSPATENKLR.L
 21.3      0.61       -8.25                    R.LAILDSQAGQIR.A
 19.1         1         768                    R.AKPVATALEDLR.A
 19.0         1        11.3                    R.RGSLPDQKDLR.L
 17.3       1.5       -0.53                    R.RLAQENVWLR.E
 16.9       1.7       -8.26                    K.DLDEVRIGVLR.H
 16.6       1.8        2.61                    R.AVKPNKDNSRR.V
 11.0       6.5      -16.99                    K.EQKRLDQVIR.Q
Top scoring peptide matches to query 1215
Elution from: 37.87 to 41.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 31625133.4 FinneganScanNumber: 2909
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 39.4    0.0093        0.49   13   IPI00003421 K.LSPVLDGVSELR.H
 30.8     0.068       -0.53                    R.APASAAWRSVLR.V
 18.6       1.1        11.3                    R.RGSLPDQKDLR.L
 18.4       1.2       -8.25                    R.LAILDSQAGQIR.A
 17.3       1.5         768                    R.AKPVATALEDLR.A
 13.9       3.3        5.58                    NMVPQQALVIR
 13.2       3.9         778                    K.LCLYISFVIR.I
 12.5       4.6         787                    R.RSPAPSLTTPTR.A
 11.8       5.4        11.4                    K.LQQRIDELNR.E
 11.8       5.4       -0.54                    K.HIAFIGDSRIR.Q
Top scoring peptide matches to query 1216
Elution from: 37.88 to 41.88 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 31625133.4 FinneganScanNumber: 2913
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 37.4     0.015        0.49   13   IPI00003421 K.LSPVLDGVSELR.H
 24.2      0.31        11.3                    R.RGSLPDQKDLR.L
 20.7      0.69       -0.53                    R.APASAAWRSVLR.V
 20.4      0.74         768                    R.AKPVATALEDLR.A
 17.1       1.6        11.4                    R.ILAQSNNQQLR.D
 16.6       1.8       -8.25                    R.LAILDSQAGQIR.A
 16.6       1.8      -16.98                    R.RLSPATENKLR.L
 16.5       1.8        2.61                    R.AVKPNKDNSRR.V
 14.9       2.7       -0.53                    R.RLAQENVWLR.E
 13.4       3.7         789                    R.HVQWLMGKLR.F
Top scoring peptide matches to query 1217
Elution from: 37.85 to 41.84 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 31625133.4 FinneganScanNumber: 2908
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 34.2     0.031        0.49   13   IPI00003421 K.LSPVLDGVSELR.H
 22.4      0.47       -0.53                    R.APASAAWRSVLR.V
 16.9       1.6         768                    R.AKPVATALEDLR.A
 14.3       3.1        11.3                    R.RGSLPDQKDLR.L
 12.9       4.2         778                    K.LCLYISFVIR.I
 10.6       7.1        8.18                    K.HGDIFTILVGGR.Y
 10.3       7.7        2.61                    R.AVKPNKDNSRR.V
 10.0       8.1        5.58                    R.LMGSVKDHLLR.E
  9.5       9.2         773                    R.GCLRSLSLHIK.T
  8.6        11         779                    K.EEKPRARELR.I
Top scoring peptide matches to query 1218
Elution from: 26.40 to 30.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 486499.9 FinneganScanNumber: 1649
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.3       5.5         776        K.DIPGLTDTTVPR.R
 10.8       7.8         767        R.GTGGGNXKQLPDK.W
 10.8       7.8         767        R.GTGGGNXKQLPDK.W
 10.2         9        10.6        K.MMRAAAKDVHR.L
  9.8        10       -8.33        K.TLPIQAQSQGSR.T
  8.7        13         798        K.ITGYVVEMQTK.G
  7.8        16         795        R.GSGAEGKPGPQTAK.E
  7.6        17         800        K.SRCTTPGHLQK.A
  7.1        19         787        R.HSAASAAAVAVSSR.Q
  7.0        19         787        R.SHTAEKGQLASR.R
Top scoring peptide matches to query 1219
Elution from: 26.40 to 30.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 486499.9 FinneganScanNumber: 1651
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.0        19        10.6        K.MMRAAAKDVHR.L
  6.1        23         787        R.SHTAEKGQLASR.R
  5.1        30        8.13        R.KRQIYGYDSR.F
  4.6        33         795        R.DSVGVGPSKPGER.A
  4.3        35        20.0        K.ERTNGDIVPER.G
  4.0        38      -19.18        R.ESVVGDIPKDVK.N
  3.3        44         794        R.NFVGDLGGGHRR.D
  2.5        53       -8.31        R.RSLDSPAALAER.G
  2.0        59        17.2        K.MMESYIAVLTK.G
  1.3        71        0.43        K.ELLGLQQAEER.L
Top scoring peptide matches to query 1220
Elution from: 37.95 to 41.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 2926
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.6       3.2         771        -.MVALVRSDGALR.S
 13.5       5.3         783        K.LANVPDGSFLVR.D
 12.9         6        3.66        R.LERRVTGSTNR.W
 12.9       6.1         763        R.ALGRMVERSLR.S
 12.2       7.1         771        R.VMVEGVGARVVR.G
 11.8       7.8        17.5        K.LNQMRREGIR.Y
 11.1       9.2         766        K.DVTAKKDLELR.R
  8.4        17         789        K.SIPVTQELICK.A
  8.0        19         786        -.XTLQTAAQATLR.Q
  7.6        21         771        K.NRMLLIENLR.E
Top scoring peptide matches to query 1221
Elution from: 40.26 to 44.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 650550.4 FinneganScanNumber: 3096
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1222
Elution from: 40.26 to 44.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 428947.2 FinneganScanNumber: 3097
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1223
Elution from: 38.10 to 42.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1133941.4 FinneganScanNumber: 2941
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.2       4.7         795        -.MIASIKSQKDR.V
  7.1        15        18.3        K.RYRAASGGQSLK.C
  3.1        38         789        K.LKITGNMGLAMK.L
  3.1        38         789        K.LKITGNMGLAMK.L
  2.3        46         795        K.KDGQRLSTLMK.R
  2.3        46         783        K.RVFKVVEEMR.G
  1.0        61         789        -.MAMNIISKEKK.E
  1.0        61         792        R.SRLSATTRSTGR.C
  1.0        62        18.2        R.YTRGTPSTRVR.G
  0.7        66        18.2        K.HNNTPLVKASGR.E
Top scoring peptide matches to query 1224
Elution from: 38.24 to 42.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1133941.4 FinneganScanNumber: 2963
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.3        11         783        M.GKAFKVMNELR.S
  8.3        11         783        K.RVFKVVEEMR.G
  8.3        11         769        R.IVHSPEVKQQK.R
  4.8        26        4.21        R.MMVRAAVLKMK.D
  3.8        32         792        R.SMKVAYSILHK.L
  3.0        39         789        -.MAMNIISKEKK.E
  2.6        43         789        K.SGLIPPREGPGGR.R
Top scoring peptide matches to query 1225
Elution from: 37.34 to 41.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4266398.1 FinneganScanNumber: 2823
Score greater than 15 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.0        19        15.7        R.LSSLIIGPSKER.T
  3.0        19       -4.65        R.NFVNIRPAKLK.N
  2.8        20        15.7        K.VSLVLSALQAGNK.G
  2.4        22        7.09        R.VLRGILSGATANK.A
  1.5        27         788        K.VKPMQVAKELR.R
  1.4        27         765        R.LKGNQLAVTKAR.D
Top scoring peptide matches to query 1226
Elution from: 36.98 to 40.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4266398.1 FinneganScanNumber: 2761
Score greater than 16 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.8       7.9         790        -.XVGVEAARVIAK.A
  2.9        19         755        M.KAAVLDLGSLLAK.L
  2.9        19         783        R.VVLSAAATAAPSLK.N
  2.8        20         774        K.LRAELEAALGKK.H
  2.7        20        7.09        R.VLRGILSGATANK.A
  2.5        21        7.09        R.RLLEKVEGTVR.A
  2.3        22         774        R.DTAQILLLRGAK.Y
  2.3        22        12.6        R.AVVKIVEEWVK.N
  1.9        24       -7.25        R.LRQMLLLVSAR.C
  1.7        25      -12.28        K.LGSALLIRDTIK.I
Top scoring peptide matches to query 1227
Elution from: 37.18 to 41.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4266398.1 FinneganScanNumber: 2793
Score greater than 20 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3       6.9        17.8        M.ASIIARVGNSRR.L
  6.6       8.2        15.7        R.SALAPNLLTSGKK.K
  5.3        11       -4.65        R.NFVNIRPAKLK.N
  5.3        11        7.10        K.SLAVASKAKTPAR.H
  5.0        12        7.10        K.SKQLLQKAVER.G
  3.1        18         765        K.ITQLKNQLGRK.E
  2.8        19      -12.28        K.TLLEGISRAVLK.T
  2.7        20        14.7        R.LPRISARAPYR.L
  2.7        20        7.10        M.TELQSALLLRR.Q
  2.6        20      -12.26        K.VLTAEQKAKALK.G
Top scoring peptide matches to query 1228
Elution from: 24.77 to 28.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 432952.3 FinneganScanNumber: 1493
Score greater than 27 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 40.5    0.0078        0.89    2   IPI00011654 R.ISVYYNEATGGK.Y
 12.4         5         791                    K.VTFSCAAGFGQR.H
 10.6       7.6       -4.63                    R.KAPSEASAQEQR.E
  7.8        14      -13.29                    M.AAGGTGGLREEQR.Y
  6.6        19         763                    R.TPTVHFPQMSR.S
  5.7        23        9.00                    -.MAQSGGEARPGPK.T
  5.5        24        11.9                    K.ISMPDVDLHMK.G
  5.1        27         766                    R.RMERSLSSYR.G
  4.9        28      -18.96                    K.MNTANPERKPK.K
  4.6        30      -18.45                    K.AELDTTYTFLK.E
Top scoring peptide matches to query 1229
Elution from: 25.12 to 29.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1297701.1 FinneganScanNumber: 1539
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 23.4      0.48       -8.46        LLSMTVRRGPR
  8.9        14      -13.44        K.ELIKRAESLSR.S
  8.8        14        0.19        R.KVNIMLLNGQR.L
  8.6        14       -8.96        R.RPPPPPPPPPPR.A
  8.4        15         761        K.LKIEDIKEANK.A
  7.7        18       -2.79        K.GTRGLRVVGSSGR.L
  6.8        22         757        R.LLKENQMLRR.L
  5.7        28         776        R.LRGVHYITWR.R
  4.3        39         760        R.AALAGTRLVWSR.S
  4.1        41      -16.55        K.EILAWKVSLSR.G
Top scoring peptide matches to query 1230
Elution from: 25.14 to 29.15 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1297701.1 FinneganScanNumber: 1543
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.9       1.1         752        M.TAVNVALIRDTK.W
  7.3        19       -2.79        K.GTRGLRVVGSSGR.L
  7.3        19      -13.49        K.VQNVKSTTVAVR.G
  6.8        22       -8.96        R.RPPPPPPPPPPR.A
  6.2        25      -13.44        K.ELIKRAESLSR.S
  6.2        25         761        R.DRLDDIIVLTK.D
  5.0        33        17.5        R.IEMEVEVALLR.G
  5.0        33      -16.58        R.KFPSGPLLTSVR.F
  4.8        35       -5.87        R.LPRTIADFRGR.D
  4.8        35        0.19        R.KVNIMLLNGQR.L
Top scoring peptide matches to query 1231
Elution from: 25.33 to 29.32 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1297701.1 FinneganScanNumber: 1558
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.6        23         757        R.LLKENQMLRR.L
  6.4        24       -8.96        R.RPPPPPPPPPPR.A
  6.0        26        8.82        -.MKEEVKGIPVR.V
  5.5        29         785        R.TGNLPANMKKAR.V
  4.6        36      -13.44        K.ELIKRAESLSR.S
  4.1        41         780        R.TQIDSPLSGKVR.S
  4.0        41         775        K.GVIPLTAIEMTR.S
  4.0        42        2.77        R.ITHPPPQAALTR.A
  3.5        47      -13.47        -.XTLQTAAQATLR.Q
  3.4        48       -8.96        R.RGFLPPPPAPPR.L
Top scoring peptide matches to query 1232
Elution from: 31.15 to 35.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 665860.8 FinneganScanNumber: 2054
Score greater than 17 indicates homology
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.6      0.87      -14.21        R.SYSFWGGQGCR.Y
  4.1       3.9        14.8        R.FSEDDPEYMR.L
  3.4       4.6         779        R.TESSQASDMMGK.A
  2.9       5.1        11.1        R.FGAGCGMGFGDGR.G
  0.3       9.3         774        KMSEMEEEMK
Top scoring peptide matches to query 1233
Elution from: 37.34 to 41.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1093258.5 FinneganScanNumber: 2822
Score greater than 23 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.4       1.6         786        K.LVMSQANVSRAK.A
  9.7       9.1       -8.80        -.MVPLKIEFRR.L
  7.7        15         773        K.SREGLSNKVSVK.L
  7.1        17         778        R.SLGLQYLPDAVK.G
  6.4        20         780        -.XPLPHADASRAR.D
  6.4        20         780        -.XPLPHADASRAR.D
  6.3        20         786        K.TLLARACAAQTK.A
  6.2        21         783        R.LWNMVNVTKAK.G
  6.1        21       -2.09        K.AENTLSKLLSTK.L
  6.0        22         767        K.VTIPTMTLSRGK.V
Top scoring peptide matches to query 1234
Elution from: 17.70 to 21.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 141398.8 FinneganScanNumber: 909
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 26.2      0.27       -0.61    7+  IPI00220327 NKYEDEINKR
 10.3        10         780                    R.FNNRQDSDALK.S
 10.1        11         757                    R.QLRLHNDMHK.G
 10.0        11         750                    K.ELMSATEKARR.E
  9.5        13         761                    K.IREFEVETER.L
  9.2        13         775                    K.RGPSFMTSPSPK.H
  8.9        14        16.0                    K.KTCSATEEARR.L
  8.7        15        7.95                    K.SSFPETEEKVR.R
  8.5        16         752                    R.SSSSWIESLRR.K
  8.2        17         772                    R.HSPQQPSNGSLR.S
Top scoring peptide matches to query 1235
Elution from: 17.70 to 21.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 406352.9 FinneganScanNumber: 910
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 28.6      0.15        0.03    7+  IPI00220327 NKYEDEINKR
 12.7       5.9         762                    K.KDQQFKEQEK.T
 12.1       6.9       -8.57                    M.ELRSGAAYSAQR.M
 10.7       9.5      -19.89                    R.AGLFMKIEPMR.E
  9.9        11        11.0                    -.MLPEMKRESR.M
  9.4        13         787                    R.MKEEEQAGKNK.L
  9.1        14      -14.26                    MNSGILQVFQR
  8.9        14       -9.25                    K.AMWMVKSRQR.E
  8.8        15         762                    R.QELESFGDVKR.W
  8.4        16       -9.25                    K.AMWMVKSRQR.E
Top scoring peptide matches to query 1236
Elution from: 17.68 to 21.67 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 406352.9 FinneganScanNumber: 907
Score greater than 29 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 19.8       1.2        0.03    7+  IPI00220327 NKYEDEINKR
 18.9       1.4        6.02                    K.MSDGKKEELQK.S
 14.9       3.6       -2.58                    K.RSTVDSKAMGEK.S
 13.2       5.4         787                    R.MKEEEQAGKNK.L
  9.6        12        11.0                    R.LEKMVSGCQTR.S
  9.6        12         751                    -.XKDSNSMVRIK.T
  9.5        12        0.02                    R.KNSTAAEAFGNAK.T
  9.4        13        2.43                    ARAAQMEKTMR
  9.3        13       -2.58                    -.XKDSNSMVRIK.T
  9.3        13         764                    R.EIMRSRQEMK.N
Top scoring peptide matches to query 1237
Elution from: 37.07 to 41.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8157080.3 FinneganScanNumber: 2774
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.9        11         757        K.KTWGTVFKTLK.S
  3.8        23        7.23        K.QIGDNLIVPGGVK.T
  3.1        27         768        R.IEPPKKVPSADK.R
  3.0        28         749        K.VVVEDTVPIIPK.E
  2.6        30        6.22        R.VPAHQVLFSRR.G
  1.7        37         770        R.RAGGGGGAGPVVVVR.Q
  1.7        37         779        K.TMKMLKLLGNK.R
  0.6        48        15.1        K.ILGKCVVMFVK.E
  0.3        51         787        R.ARASARAGIHLW.-
Top scoring peptide matches to query 1238
Elution from: 37.39 to 41.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8157080.3 FinneganScanNumber: 2827
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.8        12         782        K.MPPPTILSTVPR.Q
  2.0        35         779        K.KHLSIEQLNAR.R
  1.3        41         779        R.AYLASVGTRKSR.I
Top scoring peptide matches to query 1239
Elution from: 37.16 to 41.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8157080.3 FinneganScanNumber: 2791
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.5       6.1        14.3        -.MRPAAGAARRPR.C
  3.4        25        7.25        R.LTLIALDGGSPPR.S
  2.1        34         768        R.KEAVSLVKGSYK.T
Top scoring peptide matches to query 1240
Elution from: 37.36 to 41.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26315580.6 FinneganScanNumber: 2826
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.6       7.5         782        K.MPPPTILSTVPR.Q
  1.9        35         779        K.VEGQGSPIPLRR.L
  1.7        37       -6.70        R.VLLGHLLMELR.E
  1.2        41         751        R.SPAAPEALRKLR.S
  0.9        44       -1.05        K.HTVKDLLAEKR.S
  0.8        45         787        K.VRAHHYSVALR.R
  0.4        49       -9.63        R.LKAGASPRSVPAR.K
Top scoring peptide matches to query 1241
Elution from: 37.05 to 41.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26315580.6 FinneganScanNumber: 2772
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.0        43       -6.70        R.VLLGHLLMELR.E
  0.8        45         787        K.VRAHHYSVALR.R
Top scoring peptide matches to query 1242
Elution from: 37.01 to 41.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26315580.6 FinneganScanNumber: 2766
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.7        15         782        K.MPPPTILSTVPR.Q
  5.3        16         787        -.MVLAMLGALHPR.A
  3.7        23         760        R.VRPLLPSELER.Q
  3.2        26         787        K.VRAHHYSVALR.R
  1.6        37       -6.70        R.VLLGHLLMELR.E
Top scoring peptide matches to query 1243
Elution from: 37.01 to 41.00 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 26315580.6 FinneganScanNumber: 2765
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.1        27         779        K.VEGQGSPIPLRR.L
Top scoring peptide matches to query 1244
Elution from: 41.02 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 10065132.8 FinneganScanNumber: 3158
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1245
Elution from: 41.02 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18615211.1 FinneganScanNumber: 3157
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1246
Elution from: 41.02 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18615211.1 FinneganScanNumber: 3156
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1247
Elution from: 41.92 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 18615211.1 FinneganScanNumber: 3249
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1248
Elution from: 41.12 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 24465074.8 FinneganScanNumber: 3168
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1249
Elution from: 41.12 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 24465074.8 FinneganScanNumber: 3169
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1250
Elution from: 19.27 to 23.28 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1393958.3 FinneganScanNumber: 1014
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.2       2.3       -2.23        K.MGISASTMTMKK.E
 11.9       3.9       -2.23        K.MGISASTMTMKK.E
  9.7       6.5       -0.03        K.HNDGNFTEKQK.I
  9.4         7         773        -.MAAAAAQGGGGGEPR.R
  9.0       7.7         754        R.LCEGTPQEGGLR.A
  8.3         9       -0.02        R.QAQEHYNATQK.G
  5.7        16        5.95        R.LSDDKMEHAQK.L
  5.1        19       -8.20        R.SAMPADAPLCLR.L
  4.6        21         773        M.NSNASEHTGMLR.T
  4.4        22       -8.19        R.HIMAEMIATER.E
Top scoring peptide matches to query 1251
Elution from: 19.25 to 23.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1393958.3 FinneganScanNumber: 1011
Score greater than 29 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.2       1.5      -14.21        R.FGCRHVTSPVAS.-
 15.0       1.9       -2.23        K.MGISASTMTMKK.E
 13.9       2.5       -2.23        K.MGISASTMTMKK.E
  8.6       8.4         743        -.MYNMMLLIQK.R
  7.9       9.9      -10.60        K.AYGGTTEYAASVK.G
  7.7        10       -2.23        K.MGISASTMTMKK.E
  7.7        10         749        K.QDEEIVAEEVR.I
  7.3        11       -8.19        R.HIMAEMIATER.E
  7.3        11       -8.19        R.HIMAEMIATER.E
  7.3        11        13.8        K.MATDMFLAVMR.F
Top scoring peptide matches to query 1252
Elution from: 41.18 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5442535.4 FinneganScanNumber: 3173
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1253
Elution from: 34.48 to 38.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 336624.0 FinneganScanNumber: 2373
Score greater than 27 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 19.1       1.1       -0.76   15+  IPI00019502 K.LDPHLVLDQLR.C
 18.4       1.3         774                    R.IIYRPVAGGESR.E
 13.4       4.1        15.8                    R.RANLTSMLIQR.V
 12.1       5.5        10.2                    R.QVAVKMMDLRK.Q
 11.0       7.1         774                    R.RADSVSLIPGFR.V
  9.6       9.8         774                    R.FGPQTLERITR.D
  9.6       9.8        15.8                    R.NMATLKDITRR.L
  7.6        16      -19.81                    K.VAKAYAALAALEK.L
  7.5        16         747                    R.RKGLAFLDELR.Q
  7.5        16        6.76                    R.VPRPPPLYSHR.M
Top scoring peptide matches to query 1254
Elution from: 34.55 to 38.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 307695.7 FinneganScanNumber: 2378
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 14.5       3.1        0.18   15+  IPI00019502 K.LDPHLVLDQLR.C
 10.7       7.4         748                    R.NLYLAREGLIR.A
 10.2       8.4         762                    R.KPVSEKIMEIK.L
  9.8       9.2         775                    R.IIYRPVAGGESR.E
  9.5       9.8         747                    R.DLKNGGRFVALK.R
  9.3        10       -8.32                    K.LIGEYGLRNKR.E
  9.1        11        0.21                    R.ARGLAAGIALYDK.A
  9.0        11        0.20                    R.DLRGIAFALNTK.T
  8.4        13         767                    K.FRNQNIVLSAR.T
  7.5        15         768                    K.DSLIKSKEELR.H
Top scoring peptide matches to query 1255
Elution from: 26.78 to 30.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 702421.0 FinneganScanNumber: 1690
Score greater than 24 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.9       1.2        19.9        K.NGSEADMDTIEK.S
 10.7       2.6         765        R.EKEFECHSMK.E
  7.9         5      -16.66        R.STASGGMSMPLMR.A
  7.0       6.1         772        K.IEEDTENMAEK.F
  6.8       6.4      -19.05        R.DNNMDFTDIIK.F
  5.7       8.1         749        -.MDALCGSGELGSK.F
  5.7       8.2      -14.12        K.QMGSHEMFSKK.E
  5.7       8.3        2.50        R.GWEEARDYDGK.V
  5.5       8.5         741        R.KNVEAMSGMEGR.K
  5.6       8.5      -11.06        K.MQANSDKAMSAR.A
Top scoring peptide matches to query 1256
Elution from: 26.89 to 30.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 702421.0 FinneganScanNumber: 1701
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.0      0.61      -11.06        K.MQANSDKAMSAR.A
 16.1      0.75         749        K.MLMAAGDKDGDGK.I
 13.8       1.3       -7.53        -.MEAETGSSVETGK.K
 11.2       2.3         749        -.MPMESASSDNKK.Q
  9.0       3.9         749        K.MLMAAGDKDGDGK.I
  8.8         4       -3.08        R.NSSYYCQYIK.G
  7.3       5.6      -19.06        FEDVGGNDMTLK
  7.3       5.7      -19.05        R.DNNMDFTDIIK.F
  6.5       6.9         741        R.KNVEAMSGMEGR.K
  6.1       7.6      -11.58        K.ASEVFCWGQNK.Y
Top scoring peptide matches to query 1257
Elution from: 37.07 to 41.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8661456.3 FinneganScanNumber: 2775
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.5        16      -11.76        K.LTLEPKITVNAK.I
Top scoring peptide matches to query 1258
Elution from: 37.09 to 41.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8661456.3 FinneganScanNumber: 2778
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.2        13       -1.26        K.LVSAQQKAPTRK.S
Top scoring peptide matches to query 1259
Elution from: 37.34 to 41.33 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 8661456.3 FinneganScanNumber: 2821
Score greater than 13 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.3        42         758        K.LXSILTAPSPASR.Q
  0.3        42         758        K.LXSILTAPSPASR.Q
Top scoring peptide matches to query 1260
Elution from: 32.73 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1286907.5 FinneganScanNumber: 2191
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.4        10         739        R.SLDSPTSSPGAGTR.Q
  7.7        12       -3.61        K.DAMYGNFMLKK.D
  7.4        13      -13.93        R.SSSLPMSHSSLXK.K
  7.2        13      -14.94        R.GMGPGTPAGYGRGR.E
  7.0        14         741        R.MSLEQYSFRR.C
  6.0        18        4.94        M.EVEAALGCSGQGR.G
  5.4        21         738        R.SSPNQGSWRGTR.R
  5.4        21        13.4        -.MAEDVSSAAPSPR.G
  5.2        22         760        -.MMGEAYMRLSK.L
  4.6        25         760        -.MMGEAYMRLSK.L
Top scoring peptide matches to query 1261
Elution from: 18.90 to 22.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 235081.3 FinneganScanNumber: 986
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.1       4.8         744        R.SNIRDNVEMIK.L
 12.4         7         768        R.LIYNTHMADEK.L
 11.8       8.1         748        K.KFNMIPFEHR.S
  9.3        14         771        R.ELMMFYIDLK.Q
  7.4        22         771        M.IAETPMNQASTR.S
  7.3        23         743        R.SGDTSVHIFPFK.K
  7.1        24         738        K.YLIQCLAYYK.C
  7.0        25      -10.75        R.QMSVRQVSQTR.F
  6.4        28      -10.21        K.ALIENADAVYEK.I
  6.1        30       -5.35        M.FSRPTPDQLMK.D
Top scoring peptide matches to query 1262
Elution from: 29.03 to 33.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 674974.9 FinneganScanNumber: 1873
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 32.0     0.078        0.07    2+  IPI00011654 R.IMNTFSVVPSPK.V
 13.1       6.1        14.0                    K.TVDIDAFQDALK.I
 12.4       7.2         749                    R.EDVLAGMSGKAIK.G
  7.9        20        3.09                    R.NMTGLVDLTLSR.N
  6.9        25         762                    R.NQEGLGPIVHDR.K
  6.9        25        14.0                    K.LFPADTSPSTATK.I
  6.9        25       -2.81                    K.GVQLQTHPNVDK.K
  6.8        26         746                    R.MQAMLKTAERR.F
  6.5        28         768                    K.QNSMTIDELRK.A
  6.1        30      -13.23                    R.IFEDVKELTGGK.V
Top scoring peptide matches to query 1263
Elution from: 28.91 to 32.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 674974.9 FinneganScanNumber: 1862
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 45.4    0.0035        0.07    2+  IPI00011654 R.IMNTFSVVPSPK.V
 13.2         6         743                    R.GGQLISELFTNR.K
 12.5         7         743                    K.STALTWLSKDGR.Q
  9.9        13      -15.74                    K.KVLSSVSDEMLK.E
  9.7        13      -13.23                    R.IFEDVKELTGGK.V
  8.0        20         763                    R.EIVSQTTATQEK.S
  7.5        22        17.0                    R.NLTTSLTESVDR.N
  7.4        23         771                    R.ENFSPEGKSALR.D
  7.2        24         758                    K.DKEALMEEILK.L
  6.8        26       -2.79                    K.DLHVPNEDRIK.Q
Top scoring peptide matches to query 1264
Elution from: 38.48 to 42.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 570800.4 FinneganScanNumber: 2981
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.9        36         755        R.ERIGAKHQELR.E
Top scoring peptide matches to query 1265
Elution from: 38.27 to 42.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 570800.4 FinneganScanNumber: 2966
Score greater than 13 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.7        60         736        R.VGLPPAGTAELRR.G
Top scoring peptide matches to query 1266
Elution from: 41.88 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9091646.5 FinneganScanNumber: 3245
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1267
Elution from: 41.27 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9091646.5 FinneganScanNumber: 3182
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1268
Elution from: 41.27 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9091646.5 FinneganScanNumber: 3181
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1269
Elution from: 37.43 to 41.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2310115.6 FinneganScanNumber: 2833
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       2.4         749        K.RDAISLAIKDIK.E
  8.2       5.1       -3.97        R.VGDLILAHLHKK.C
  7.7       5.8         735        -.MGGLVARALLTLK.N
  6.0       8.6        6.40        R.DRLPHLRAPLR.V
  3.4        16        15.7        K.VGVVKQTETAALK.A
  2.6        19      -18.69        R.RRRPPRPRPR.A
  2.5        19         730        K.LGSATIVNITILK.N
  2.2        20        1.89        R.DMKGALGKLLGIK.T
  2.2        21        14.8        R.RDSLFIPIRAR.E
  2.1        21        10.3        R.LVLSELLAIMNK.V
Top scoring peptide matches to query 1270
Elution from: 37.19 to 41.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2310115.6 FinneganScanNumber: 2796
Score greater than 21 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.1       3.3         758        K.IAESILKEAQIK.V
  9.9       3.5        12.7        R.TPIIAGGLFVIDK.A
  7.7       5.8         762        -.MVRINVLADALK.S
  7.3       6.4         765        R.GFALKSTHGIAIK.S
  6.9       6.9         730        K.LGSATIVNITILK.N
  4.0        13      -12.35        K.LVRFLPRTVSR.L
  2.6        19         758        K.AALLKKTLENLE.-
  2.4        20         765        R.ASWIAQKLNLAK.T
  2.4        20         765        K.LVHVAGPGPTGPIK.I
  2.2        21         749        R.VLASLSGSVLAGLR.T
Top scoring peptide matches to query 1271
Elution from: 23.73 to 27.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 399058.1 FinneganScanNumber: 1379
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.1       2.9       -4.90        R.SADCSVPSPALDK.T
  7.8       7.9         740        K.DQFHESRVDGR.M
  6.1        12         758        K.AAHGGHSGGGSEGHK.L
  5.6        13       -0.41        R.GWADSPGSGSRXGR.Y
  5.1        14         732        R.EHIAKRAMENM.-
  4.8        16      -19.08        R.RDEWTQTSPAR.K
  2.2        28        15.7        K.LCHMDTIDWR.D
  1.4        35      -18.06        K.DAEAAEATAEGALK.A
  1.2        36      -11.37        R.HGLSMEIMWAR.M
  1.1        37        16.3        R.NQTSQAESYYR.H
Top scoring peptide matches to query 1272
Elution from: 23.73 to 27.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 298378.7 FinneganScanNumber: 1378
Score greater than 23 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.6       1.2        13.5        R.GTSETQRMYMK.H
 14.2       2.1        13.5        R.GTSETQRMYMK.H
  9.6       6.2        5.80        R.GGGEGGSSSEPVTAR.M
  8.5         8       -5.51        K.QVHHKENTEPE.-
  7.1        11        19.0        K.LSEGGPGSGMENGR.D
  6.5        12      -12.86        R.ETDKSPTSTEPR.Q
  5.2        17        8.03        R.MDLPSLEHMMK.A
  4.8        19         732        K.CGKNGDKDPDLK.E
  4.7        19         753        R.SPASQADGQSGWR.C
  2.5        31         739        R.DFYASQYPEVK.E
Top scoring peptide matches to query 1273
Elution from: 37.23 to 41.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6788693.5 FinneganScanNumber: 2802
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.0       8.6       -9.86        R.KNSSALHSLLKR.V
  7.5       9.7        17.0        M.KHQTNISELKR.T
  7.3        10         761        R.RLESIWQHRK.V
  4.8        18        18.9        M.LIFLGCYRRR.L
  4.5        19         762        R.DLELLKQASKAH.-
  3.9        22        17.0        R.AQXSLPRAAALER.X
  3.0        27       -2.21        -.MSHLPMKLLRK.K
  2.5        30         726        K.VLADPRLTALQR.D
  1.7        37        17.0        K.HRDSIVETLKR.H
  1.4        39        19.9        R.AMASVAQKKIYK.Y
Top scoring peptide matches to query 1274
Elution from: 37.45 to 41.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6788693.5 FinneganScanNumber: 2841
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.0        27        19.9        K.LVMKAYRDTIK.I
  2.7        29        11.5        K.APHKSLSVMLVR.N
  1.0        44        3.26        K.IHLMQNGKRLK.K
  0.7        46         742        R.ALVLAWDPGVRR.H
Top scoring peptide matches to query 1275
Elution from: 37.26 to 41.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6788693.5 FinneganScanNumber: 2809
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.0        17         753        R.VDPRIGGGGVQLGK.W
  0.9        44       -9.86        R.KNSSALHSLLKR.V
  0.1        53       -2.20        -.MSHLPMKLLRK.K
  0.1        53        8.72        R.TAPGAAPTSLRRR.R
Top scoring peptide matches to query 1276
Elution from: 37.25 to 41.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12194602.3 FinneganScanNumber: 2808
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.4        31         724        -.XTLSFLAYIIR.I
  2.1        33         754        R.GEAILAVSSRPPR.E
Top scoring peptide matches to query 1277
Elution from: 37.25 to 41.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12194602.3 FinneganScanNumber: 2807
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.1       6.6         732        R.INLSKIDKFFK.Q
  8.5       7.6       -0.96        R.RIGQEAITQPLK.K
  5.2        16         754        R.NIIYMFLPITK.W
  4.9        17       -3.94        K.QTGIYAGKKLFK.C
  4.8        18        14.7        R.LGEVGRRLYYK.L
  4.1        21         762        R.ALPIDRPNTLDK.W
  4.1        21        3.87        K.RKHLCLSIAQK.V
  4.0        21         759        K.KVFEKLQADFK.I
  3.4        25         754        K.KSGPQVKLSGSHK.W
  0.1        52         759        R.DLLGLHNMKRR.Q
Top scoring peptide matches to query 1278
Elution from: 37.30 to 41.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12194602.3 FinneganScanNumber: 2813
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.2        10         754        R.TGSEGLALPRVPR.F
  7.1        10         754        R.GEAILAVSSRPPR.E
  3.1        27         724        -.XTLSFLAYIIR.I
Top scoring peptide matches to query 1279
Elution from: 37.58 to 41.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 12194602.3 FinneganScanNumber: 2859
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.2        20        6.35        K.VGAVPPAKPQHPR.T
  3.9        22         751        R.QFLIKAPEGPPR.K
  2.3        32         754        K.SLMAKLSSMKIK.V
  2.0        34         735        K.KDVQILVVGEPR.V
  1.9        35         751        K.YASNLLKAGFIR.H
Top scoring peptide matches to query 1280
Elution from: 33.94 to 37.92 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 401235.0 FinneganScanNumber: 2307
Score greater than 20 indicates homology
Score greater than 28 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 30.5     0.031        0.70    6   IPI00011569 R.LGGIPVGVVAVETR.T
  5.7       9.4         754                    K.IILNTAVAEFFK.S
  5.5       9.8        13.7                    K.VRTAIMASVYKK.A
  5.0        11       -7.51                    R.AVLGPVPLTRTSR.T
  4.8        12         719                    K.FQKGIIQYLKK.F
  3.9        14         722                    R.SILAKLQAKHEK.L
  3.4        16        10.9                    R.AVPLGQRAGALGTR.D
  3.0        17         740                    K.DLPGLKTPVGRGR.A
  2.0        22         743                    R.KSLVMHTPPVLK.K
  1.9        22      -15.71                    K.RALRELGSVPLR.L
Top scoring peptide matches to query 1281
Elution from: 32.12 to 36.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2403734.9 FinneganScanNumber: 2145
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 33.2     0.022       -0.93    1   IPI00301263 R.LPGLIDVHVHLR.E
  5.8        12      -13.55                    R.LPGLSLAACLLLK.Q
  0.3        42        7.30                    K.LPAWIRASVEVK.A
Top scoring peptide matches to query 1282
Elution from: 32.08 to 36.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2403734.9 FinneganScanNumber: 2138
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 38.5    0.0065       -0.93    1   IPI00301263 R.LPGLIDVHVHLR.E
  7.4       8.3         719                    K.HARYTLKPLLR.G
  2.9        23        10.2                    K.LPRPLTSSASAIR.K
  1.4        33        10.2                    R.LGGGLGDGGGLVLKR.R
  0.7        39       -3.36                    R.RILLIKNMDPR.L
  0.3        42         751                    K.HLRGLDLAVMVK.Q
Top scoring peptide matches to query 1283
Elution from: 32.08 to 36.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2403734.9 FinneganScanNumber: 2139
Score greater than 26 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 40.7    0.0039       -0.93    1   IPI00301263 R.LPGLIDVHVHLR.E
 11.6       3.1      -13.55                    R.LPGLSLAACLLLK.Q
  5.1        14        7.30                    K.LPAWIRASVEVK.A
Top scoring peptide matches to query 1284
Elution from: 32.14 to 36.15 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 962635.8 FinneganScanNumber: 2148
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 84.7   1.5e-07       -0.15    1   IPI00301263 R.LPGLIDVHVHLR.E
 16.7      0.92      -12.76                    R.LPGLSLAACLLLK.Q
  7.8       7.3         744                    R.KTGHVIAVKQMR.R
  7.7       7.4        11.0                    K.LPRPLTSSASAIR.K
  7.5       7.8       -0.11                    K.NFAELKIKHLR.K
  4.6        15         749                    R.LPGQRLDRLGSR.K
  2.5        25        11.0                    K.VGVEAKKPNSAIR.K
  2.0        27         749                    K.KGRPKAENQALR.D
  1.3        32         739                    R.SLRAELELPAIR.Q
  1.3        33        5.61                    K.LIVVGVGKPAEMR.S
Top scoring peptide matches to query 1285
Elution from: 32.08 to 36.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 962635.8 FinneganScanNumber: 2141
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 52.0   0.00027       -0.15    1   IPI00301263 R.LPGLIDVHVHLR.E
  5.9        11         744                    R.KTGHVIAVKQMR.R
  3.2        21        15.8                    M.VRPGLARMSLPR.C
  2.3        26         752                    K.HLRGLDLAVMVK.Q
  1.1        34      -12.76                    R.LPGLSLAACLLLK.Q
  0.8        36         723                    R.LKVGRPQASQRK.L
  0.3        41       -2.58                    R.RILLIKNMDPR.L
  0.3        41         752                    R.ALGLAHVAIKCSK.N
  0.3        41       -0.11                    K.NFAELKIKHLR.K
Top scoring peptide matches to query 1286
Elution from: 32.08 to 36.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 962635.8 FinneganScanNumber: 2140
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 58.1   6.8e-05       -0.15    1   IPI00301263 R.LPGLIDVHVHLR.E
  5.3        13         752                    K.HLRGLDLAVMVK.Q
  5.2        13      -12.76                    R.LPGLSLAACLLLK.Q
  3.0        22       -7.37                    R.SSKEPLVIQVLR.R
  3.0        22        11.0                    K.LPRPLTSSASAIR.K
  1.3        32         728                    K.NLPVFQPGVKLR.D
Top scoring peptide matches to query 1287
Elution from: 37.47 to 41.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1349631.1 FinneganScanNumber: 2845
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.0        43         743        R.ERIKQQIALDR.A
Top scoring peptide matches to query 1288
Elution from: 37.58 to 41.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1349631.1 FinneganScanNumber: 2863
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.7        18        19.1        R.IQLQKVLGPSCK.V
  3.5        24         725        K.IENKIEGIGLKR.T
  2.8        28         743        R.RKQELLADIQR.L
  2.2        32       -2.07        K.IEGARSVLRLEK.I
  1.4        39         748        R.RRVLPMQVQSR.E
  0.8        45         740        R.GIINPFPASKGIR.A
  0.7        46         733        K.QLLVQQLGLTEK.S
Top scoring peptide matches to query 1289
Elution from: 37.54 to 41.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3766160.6 FinneganScanNumber: 2853
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.1        17         723        K.LGLSVFTVIPRPA.-
  4.3        20         726        R.EATLELLGRVLR.D
  4.0        21         731        K.LVLGQMVQAVRR.D
  3.7        23         744        K.KRPSDVQSALLR.R
  3.6        24         726        K.KELAALLEAQKR.T
  3.5        24         744        R.VRADVTINLNVR.D
  3.2        26         747        R.HKMTLISPSVLK.K
  0.6        47      -19.37        K.ANIKDLSQILKK.M
Top scoring peptide matches to query 1290
Elution from: 37.30 to 41.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3766160.6 FinneganScanNumber: 2816
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.8        11         726        K.KELAALLEAQKR.T
  3.7        23         744        R.LLQLSLERNGAR.A
  3.6        23         726        R.EATLELLGRVLR.D
  2.5        30         731        K.LILLRAMRPDR.M
  2.0        34       -1.01        K.EISKLKQQLQR.T
  1.7        36         729        R.DLIKVVNMVLPL.-
Top scoring peptide matches to query 1291
Elution from: 37.30 to 41.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3766160.6 FinneganScanNumber: 2811
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.8        11         736        R.VLEATARAGGRIR.S
  6.7        11         726        K.KTPAAEAKTLLAR.L
  6.1        13         747        R.HKMTLISPSVLK.K
  2.5        30         726        R.TNIIKVGDLGIAR.V
  2.0        34         744        R.VRADVTINLNVR.D
Top scoring peptide matches to query 1292
Elution from: 41.60 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4406865.6 FinneganScanNumber: 3217
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1293
Elution from: 41.62 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1388848.8 FinneganScanNumber: 3218
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1294
Elution from: 25.54 to 29.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 381622.4 FinneganScanNumber: 1573
Score greater than 18 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5       8.3         733        R.DDEMENKQDVR.I
  5.1       9.2         711        R.CAGPSNSMQLASR.S
  4.5        11       -0.94        K.MSWSEEAAQNAR.I
Top scoring peptide matches to query 1295
Elution from: 28.51 to 32.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 520055.8 FinneganScanNumber: 1832
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.1       3.7         728        R.MEHPSSPRGARR.Y
 13.5       5.4         741        R.DNWVFCGGKGIK.T
 11.7       8.1       -3.94        K.WWGQDPPVQLR.S
 10.8        10        7.12        R.DWRGPPNSPDLK.L
 10.4        11         718        R.LFLMDREERR.Q
 10.2        11      -13.54        M.DFVMKQALGGATK.D
  7.5        21         726        R.AMVELDFEVRR.E
  7.2        23      -16.31        R.KTAEHTGEGRPAK.L
  7.1        23         729        K.TDTLEDLFPTTK.I
  7.0        24         740        R.SPLPEEGSPPQSR.E
Top scoring peptide matches to query 1296
Elution from: 28.74 to 32.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1646340.9 FinneganScanNumber: 1849
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.5        10       -1.12        K.EQSEVGSMGALLF.-
  2.9        31       -1.11        R.ILVEMEDEFSR.R
  2.4        34      -14.93        K.AGTEDELVAHWR.R
  1.5        42       -1.12        K.KLMFKTEGPDSD.-
  0.8        49        19.5        R.GDGSRFPEVFSAD.-
  0.2        57         714        R.TLTASENESMRK.V
Top scoring peptide matches to query 1297
Elution from: 28.58 to 32.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1646340.9 FinneganScanNumber: 1836
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2       8.9        9.90        K.VTETEDTQMVSK.G
  6.8        12         737        K.CYEEQLDLGQK.L
  2.9        31         742        R.NMRGCVRSCSR.R
  2.9        31         714        -.LSSNTMASNVTNK.M
  1.7        40         722        K.EETVATLTMTDR.V
  0.5        53         715        K.YHTVNGHNGEVR.K
  0.4        55         711        R.LEMSAVADIFDR.D
  0.2        57         745        K.EACWEAYNLAR.D
  0.0        59         716        R.VEEDSNRDYKK.L
Top scoring peptide matches to query 1298
Elution from: 28.61 to 32.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1646340.9 FinneganScanNumber: 1839
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.8        12      -17.36        R.QMNFKSNTLER.S
  6.5        13        10.8        K.YEMMPNRTWR.C
  5.5        17       -1.11        R.ILVEMEDEFSR.R
  5.0        19         737        K.CYEEQLDLGQK.L
  4.0        24        9.90        K.VTETEDTQMVSK.G
  3.9        24       -6.95        R.MKIQLMCSNSR.R
  3.5        27        9.91        -.MKSSSTSSDPDLL.-
  2.1        36         708        K.DSQLVSSGHNNPK.K
  1.4        43       -7.32        K.RTSGAVCHQDPR.T
  0.2        57      -10.22        K.GFNHSMEVIHGR.N
Top scoring peptide matches to query 1299
Elution from: 38.45 to 42.44 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2735666.1 FinneganScanNumber: 2978
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.2        13         743        K.FTAILYRTLER.R
  2.6        31         738        K.MLLFGFIVSTVR.V
  2.5        31         744        K.KEYLKQLAAYR.A
  2.3        32         740        K.LVRGHFCPIKR.K
  2.3        33         738        R.RKAEPQAVQSLR.R
  2.2        33         745        K.KQAGSKFHARPR.F
  2.2        34         743        R.LFLPAPALSNSPR.C
  1.6        38        5.00        R.GTPINKPPVLGYK.D
  1.4        40        7.92        K.VKPRVQETGEIK.E
  1.1        44         709        -.XIHRLKQSLPK.R
Top scoring peptide matches to query 1300
Elution from: 35.45 to 39.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 394604.4 FinneganScanNumber: 2499
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 53.6   0.00048        0.86    1   IPI00301263 K.LYLNETFSELR.L
 24.3      0.41        16.6                    -.MNEIKTQFTTR.E
 20.0       1.1         707                    K.EPSPLRSLNNTR.K
 20.0       1.1         712                    M.EMGRRIHSELR.N
 18.9       1.4       -9.69                    K.MKQVEHILNEK.R
 12.9       5.6         712                    K.LHVNRNNMLTR.L
 12.4       6.3         715                    K.QLVVQQPSGGNEK.Q
 12.4       6.4       -2.43                    K.GRRSHTGSVGNTR.S
 11.8       7.3       -1.56                    R.LKDMNYSEKIK.E
 11.0       8.7         745                    K.DCIELFTTKEK.L
Top scoring peptide matches to query 1301
Elution from: 35.47 to 39.46 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 394604.4 FinneganScanNumber: 2503
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 44.3    0.0041        0.86    1   IPI00301263 K.LYLNETFSELR.L
 24.8      0.36         745                    K.DCIELFTTKEK.L
 14.8       3.6        16.6                    -.MNEIKTQFTTR.E
 12.8       5.9       -9.69                    K.MKQVEHILNEK.R
  9.3        13         715                    K.LPMTFFIELEK.T
  9.0        14         721                    R.FNEIFTEKEVK.Q
  8.4        16       -2.43                    K.GRRSHTGSVGNTR.S
  8.1        17      -12.48                    R.NPATRGLPSTASGR.L
  7.3        21        8.46                    -.MQTPPPTRSGGQK.L
  7.2        21         712                    K.LHVNRNNMLTR.L
Top scoring peptide matches to query 1302
Elution from: 37.47 to 41.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 984869.3 FinneganScanNumber: 2844
Score greater than 15 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.1       7.4         712        R.MRSLSTLKPLLK.A
  2.4        14         726        R.LKKSINNLVTEK.N
  2.0        15         717        -.XQNRPLIRPKK.R
  1.1        19        12.2        K.GRVSGSRLAILMK.T
  0.5        22         715        K.TILANVVKPRLY.-
  0.3        23       -3.45        AGFKGKSKPNLLK
Top scoring peptide matches to query 1303
Elution from: 35.14 to 39.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 335638.2 FinneganScanNumber: 2451
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 52.0   0.00074        0.57    6   IPI00011569 R.DIIVIGNDITYR.I
 17.5       2.1        7.70                    K.ANVRLYHVYEK.G
 11.6       8.1        13.3                    R.APDLKGMLEVFR.E
  9.6        13        5.26                    K.NVVKICDFGLAR.D
  8.7        16       -5.57                    R.AVAAQRGAGHQLGR.-
  8.2        18        6.21                    K.DIVILVDVSGSMK.G
  7.8        20         739                    R.EYFNIHLWLR.C
  7.5        21       -0.39                    K.IGHPHGLQITYR.R
  7.5        21         732                    K.MIENLRQTELK.L
  7.4        21         735                    K.THLEKEITTYR.R
Top scoring peptide matches to query 1304
Elution from: 23.01 to 27.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 398979.8 FinneganScanNumber: 1331
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 42.2    0.0068        0.26    1   IPI00301263 R.GHNQPCLLVGSGR.C
  9.8        12         739                    R.MIDVGFEPDVQK.I
  9.0        14         724                    K.ELEGDVMKSELK.K
  7.9        18         712                    -.MRAGQQLASMLR.W
  7.0        23        10.7                    R.GQQSAFAGATGPFR.F
  6.6        25       -9.72                    R.YSGRPVNLMGTSL.-
  6.4        26         723                    R.GPPQGCPLDPLSR.A
  6.0        29        3.65                    R.QYLSTPDSQSLR.C
  5.2        34         708                    R.CLSLSAGQTTLSR.E
  5.2        34        9.32                    R.ENEELTEKMKK.A
Top scoring peptide matches to query 1305
Elution from: 29.65 to 33.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1176486.4 FinneganScanNumber: 1936
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 31.7      0.05       -0.92    1   IPI00301263 R.TPHVLVLGSGVYR.I
  9.7       7.9         730                    R.RPEPAPPVTAPHK.-
  7.2        14         731                    K.HLIEDLIIESSK.F
  5.4        22      -18.91                    R.LPLGEKLLFDPR.T
  3.0        37        10.0                    R.KNDPLPISTVGTR.G
  2.9        39        12.0                    K.RRPEPSLSRGSR.T
  2.4        43         722                    R.LWLSHRGLSXAR.E
  1.9        49         723                    R.ATTLPPAPATTVTR.S
  1.2        57        12.0                    K.RNRPNVQAISSR.L
  0.4        68        0.07                    K.ELEEIVQPIISK.L
Top scoring peptide matches to query 1306
Elution from: 29.63 to 33.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1176486.4 FinneganScanNumber: 1931
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 32.8      0.04       -0.92    1   IPI00301263 R.TPHVLVLGSGVYR.I
  5.8        20         733                    R.VPVDQVNRKDAR.A
  4.3        28        4.71                    R.TPPVGMSPQVLKK.S
  3.8        31        6.67                    R.LARPKADPMARR.R
  2.6        41      -18.91                    R.LPLGEKLLFDPR.T
  2.1        47         702                    R.LKPLAIGKCSGPR.A
  1.3        55         712                    K.KRPKPGGAGGKGMR.I
  1.1        58         704                    R.SGRIIPKPEFPR.A
Top scoring peptide matches to query 1307
Elution from: 29.63 to 33.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1176486.4 FinneganScanNumber: 1932
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 14.6       2.6       -0.92    1   IPI00301263 R.TPHVLVLGSGVYR.I
  4.6        26        6.67                    R.LARPKADPMARR.R
  2.7        40        1.97                    R.RPTLGVQLDDKR.K
  1.4        54        0.04                    K.GIITAVEPSTPTVL.-
  0.4        68         722                    K.NGKAWSKKPPGAR.L
Top scoring peptide matches to query 1308
Elution from: 29.62 to 33.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2860310.1 FinneganScanNumber: 1930
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 54.5   0.00024        0.48    1   IPI00301263 R.TPHVLVLGSGVYR.I
  8.1        11        8.06                    R.APGLRGLRLECR.G
  7.7        12         734                    R.VPVDQVNRKDAR.A
  7.2        13         708                    R.SATRVAGGPVTPRK.G
  3.7        30         724                    R.LWLSHRGLSXAR.E
  2.8        36         734                    K.ETRTLNLHGISR.N
  2.5        40         734                    R.HRPRLHSGSPPR.A
  2.0        44      -14.60                    R.LQALEKDKPSLR.V
  1.9        45        18.5                    K.QIFGNTHIGAALR.E
  1.9        45        8.06                    K.NKSGRGHMLIIR.V
Top scoring peptide matches to query 1309
Elution from: 29.65 to 33.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2860310.1 FinneganScanNumber: 1934
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 63.5   3.1e-05        0.48    1   IPI00301263 R.TPHVLVLGSGVYR.I
  9.4         8         734                    R.VPVDQVNRKDAR.A
  3.2        33      -15.25                    K.GILVVRCMKPPK.I
  3.1        34         734                    K.ETRTLNLHGISR.N
  2.9        36         734                    R.HRPRLHSGSPPR.A
  2.7        37        8.06                    K.NKSGRGHMLIIR.V
  2.5        39         737                    R.SEFTLMAKRIGK.D
  2.4        40        8.58                    K.AKYELLNAGYKK.C
  2.1        43      -17.51                    K.GFQSKVLPPLSPK.V
  2.1        43      -14.61                    K.VPEIISSIRQAGK.I
Top scoring peptide matches to query 1310
Elution from: 29.60 to 33.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2860310.1 FinneganScanNumber: 1927
Score greater than 24 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 41.6    0.0049        0.48    1   IPI00301263 R.TPHVLVLGSGVYR.I
  9.4         8        8.08                    R.LARPKADPMARR.R
  2.9        36        3.39                    K.ADVGRLSPEVKAR.S
  2.5        39         711                    K.ELVELHLKLMR.K
  2.2        42        3.38                    R.VTTQPRNKPQTK.C
  2.0        44      -14.64                    R.QTIIVVVENVQR.N
  1.0        56         737                    K.TGLKGIPEHLMGK.L
  0.8        58       -9.94                    R.TAHKAARLGITMK.A
  0.2        66        18.5                    -.XPLEAAAQTWRR.V
Top scoring peptide matches to query 1311
Elution from: 37.71 to 41.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5411728.8 FinneganScanNumber: 2885
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.3       8.5         716        R.LKPLAIGKCSGPR.A
  4.6        20         732        K.MSSVYLKEIAKK.K
  2.2        35        8.30        -.XSRAADLLAARPR.E
  1.0        46        10.1        -.MWRLPGARAALR.V
Top scoring peptide matches to query 1312
Elution from: 37.49 to 41.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5411728.8 FinneganScanNumber: 2847
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.8        38         728        R.VTRLSVSRWHR.R
  1.2        43        6.36        M.VELQPLLTEISR.T
  0.8        48       -5.53        K.HFRPIFTKVPR.F
  0.5        51         729        K.GKPSSDTVPKPKR.A
Top scoring peptide matches to query 1313
Elution from: 37.43 to 41.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5411728.8 FinneganScanNumber: 2834
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.4       6.6       -1.67        R.KPGSVVAAAAAEAKK.K
  4.9        19         737        R.QLQLSEVPVLDR.A
  3.8        24       -7.91        -.MPYLHKALLRR.G
  1.1        45         737        R.TPVTLGSDQPLLR.V
  0.1        57         711        R.ILQETVKELAPR.C
Top scoring peptide matches to query 1314
Elution from: 37.39 to 41.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5411728.8 FinneganScanNumber: 2832
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.3        42        8.31        R.ANINANLQGKARK.T
  1.3        43      -12.59        R.LLALVKWANNAGK.V
  0.2        56         710        R.FLLQHLGRVASR.A
Top scoring peptide matches to query 1315
Elution from: 37.43 to 41.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4891225.3 FinneganScanNumber: 2835
Score greater than 13 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.0        45         722        K.APAAAVVRAAVSASR.A
  0.3        54         738        R.NSGGLEPLVELLR.S
Top scoring peptide matches to query 1316
Elution from: 37.61 to 41.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4891225.3 FinneganScanNumber: 2869
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.3        13         722        K.APAAAVVRAAVSASR.A
  2.0        36       -1.70        R.QVVHKNTRFLR.D
Top scoring peptide matches to query 1317
Elution from: 37.39 to 41.37 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4891225.3 FinneganScanNumber: 2829
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        13         738        K.SPVDIVTGGISPVR.D
  4.0        23         730        K.GVEHEKIKSTLR.R
  3.5        26         704        R.LLGLEEQLRAVR.M
Top scoring peptide matches to query 1318
Elution from: 22.50 to 26.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2815886.8 FinneganScanNumber: 1276
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1319
Elution from: 30.70 to 34.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1150980.3 FinneganScanNumber: 2014
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 18.9       1.2        0.60    1   IPI00301263 R.GQPLPPDLLQQAK.C
  8.8        12        18.5                    K.SHTAAAAAEPLPLR.C
  6.4        21         720                    K.SPPADPPRVLAQR.R
  5.2        28       -7.39                    R.RLQKGEANIFTK.Q
  2.8        49       -7.40                    R.SPSVRSLFLKDR.V
  2.5        53        15.6                    K.VLQVIVWGDYGR.M
  1.9        61        18.5                    R.KRPDEVPDVPPR.K
  1.7        64         726                    -.XAGTVTVQQMLSR.G
  1.7        64         726                    -.XAGTVTVQQMLSR.G
  1.4        68        5.25                    -.MNFPVRKDIIR.I
Top scoring peptide matches to query 1320
Elution from: 30.70 to 34.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1150980.3 FinneganScanNumber: 2015
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 19.9      0.96        0.60    1   IPI00301263 R.GQPLPPDLLQQAK.C
  5.9        24        7.63                    K.TFFALGRGPSVPR.K
  2.9        48        18.5                    K.RPDEVPDVPPRK.T
  2.7        50         708                    R.DLLLTVKMDLSR.H
  2.0        59        18.5                    K.SHTAAAAAEPLPLR.C
  1.9        60       -9.79                    K.RACITKSILSQK.N
  1.6        64        18.5                    R.VHSATLAIAEQHK.R
  1.3        68         726                    -.XAGTVTVQQMLSR.G
  1.3        68         726                    -.XAGTVTVQQMLSR.G
  0.5        82      -18.26                    M.ALAPPPRGLWQAK.D
Top scoring peptide matches to query 1321
Elution from: 40.14 to 44.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1889816.3 FinneganScanNumber: 3080
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1322
Elution from: 40.23 to 44.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 368456.8 FinneganScanNumber: 3091
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1323
Elution from: 31.64 to 35.63 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 243796.1 FinneganScanNumber: 2102
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.6       2.8         730        -.XKEITKCLEFK.S
 10.3       7.6       -2.58        K.WGVSDFIKAFIK.F
  9.7       8.7         706        -.XGKPWWAPAVGRK.M
  9.3       9.5        5.86        K.KMDGYILSLVQK.K
  9.0        10        5.87        K.QTLEILKYMQK.K
  8.8        10         714        K.RSGAWFYKGLPK.Y
  8.6        11        16.1        K.IAVSKMMMVLGAK.W
  8.6        11        16.1        K.IAVSKMMMVLGAK.W
  8.4        12         702        R.LSGNNRDPALKPK.R
  8.1        12       -2.10        K.GIHLNVLELMQK.H
Top scoring peptide matches to query 1324
Elution from: 31.64 to 35.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 243796.1 FinneganScanNumber: 2103
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.6       0.7         718        K.VKLEDKSSTAFGK.R
 15.8       2.1         730        M.MDSQLVAGVAFKK.T
 12.8       4.2         730        R.GSSYPVCVSKVVK.G
 10.9       6.5         696        K.LLMQPLSSIHVR.T
 10.9       6.5         710        K.LKSYVDTGGVSRK.V
  9.9       8.1         707        R.LQQQAYSVFVVK.G
  9.2       9.7         717        M.AFMVKTMVGGQLK.N
  9.1       9.8         710        R.LSSKVAAEVPHGSK.Q
  8.6        11         714        R.LAERMAILHAER.Q
  8.3        12        0.28        R.QIFHPEQLITGK.E
Top scoring peptide matches to query 1325
Elution from: 37.65 to 41.64 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1444033.8 FinneganScanNumber: 2873
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.1        31         696        K.VKKGVNILSAQTR.E
  1.0        40         704        K.KVLKDAVNNITAK.G
Top scoring peptide matches to query 1326
Elution from: 37.45 to 41.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1444033.8 FinneganScanNumber: 2839
Score greater than 16 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.0        10      -11.43        R.SFSLGVPRLIGIR.L
  3.1        25         730        R.QQLAEKAKAGELK.V
  2.8        27        7.32        K.KKSVDIEVDLIR.F
  1.4        37        6.68        R.LVMVKVVPTCLR.A
Top scoring peptide matches to query 1327
Elution from: 29.32 to 33.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 336113.5 FinneganScanNumber: 1903
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 17.7       1.7         691                    R.XRDSRPFPRPR.D
 11.8       6.8      -11.57                    K.AAERMNIGKPNAK.D
 11.0       8.2        1.58                    K.ADLQDGKEKQQR.K
 10.3       9.7        19.4                    R.GQIGASEQRAQDR.A
 10.2       9.8         706                    K.LAAVAQGEEXNASR.S
  9.5        12       -1.28    8+  IPI00024067 K.IVLDNSVFSEHR.N
  9.5        12         718                    R.QMEIQKHKDNK.K
  9.4        12         730                    K.AGPCVMRHHPPR.S
  8.3        15        1.58                    K.ANATVDGLEQKNR.K
  7.9        17         710                    K.QQRCAVSLEPAR.A
Top scoring peptide matches to query 1328
Elution from: 29.32 to 33.32 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 365006.9 FinneganScanNumber: 1904
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 34.2     0.039        0.38    8+  IPI00024067 K.IVLDNSVFSEHR.N
 11.2       7.9      -19.80                    K.SIMTIVGHTDVVK.D
 11.1       8.1         725                    R.LPTPMPWDLSNK.A
  9.1        13        15.8                    K.GERMADGAPLAGVR.G
  6.7        22         707                    K.DGGLPSLQSNATVR.V
  5.2        31        0.39                    -.XVLIWDDAREGK.D
  5.0        33        5.00                    K.HRTSLPAPMFSR.S
  4.4        37       -4.70                    R.SPAGQASSSLAQRR.R
  4.2        39         704                    R.LQALYDPINPDR.E
  4.1        40        3.23                    -.XKSNGKTAIGDPGR.A
Top scoring peptide matches to query 1329
Elution from: 21.76 to 25.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1091604.5 FinneganScanNumber: 1197
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 30.9      0.05         704        R.CLMDQLHEELK.E
 24.4      0.22         719        K.YLQEHPEDQEK.V
 23.1       0.3         721        K.EMKQMHPNGEAK.E
 14.7       2.1      -17.77        R.CLMDLLHEELK.E
 13.9       2.5         691        R.AAGEPGTSMPPEKK.A
 13.6       2.7        3.32        K.MEPEDIPTDELK.D
 13.1         3      -17.17        R.IKPDQDDDTEIK.I
 12.3       3.6         696        K.QEKDKDDLGPDR.F
 11.5       4.4        15.9        R.FIEDTEMMIGAK.R
 11.5       4.4      -15.54        K.MMRMKSXMLQK.K
Top scoring peptide matches to query 1330
Elution from: 21.88 to 25.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1091604.5 FinneganScanNumber: 1214
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 28.2     0.094         719        K.YLQEHPEDQEK.V
 26.4      0.14         704        R.CLMDQLHEELK.E
 23.2       0.3         721        K.EMKQMHPNGEAK.E
 15.4       1.8         724        R.MLDMGFGPEMKK.L
 13.8       2.6         711        K.RYYSIDDNQNK.T
 13.0       3.1      -15.39        R.MEQDKVFYSAAK.N
 12.3       3.6        3.32        K.MEPEDIPTDELK.D
 11.6       4.2       -2.23        K.EYILSHPEDGEK.I
 11.1       4.8         721        K.EMKQMHPNGEAK.E
 10.8       5.1         691        -.MSHIDPLTTQEK.Q
Top scoring peptide matches to query 1331
Elution from: 21.72 to 25.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1091604.5 FinneganScanNumber: 1194
Score greater than 29 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.6      0.86      -17.77        R.CLMDLLHEELK.E
 15.3       1.8         719        K.YLQEHPEDQEK.V
 12.0       3.9         704        R.CLMDQLHEELK.E
 11.7       4.2         721        K.EMKQMHPNGEAK.E
 11.4       4.5         691        R.TPPACETTNPSIK.K
 11.3       4.6         713        R.GHCIEGSSRGPMK.L
  8.5       8.7         691        -.MSHIDPLTTQEK.Q
  8.3       9.1         704        K.NQEMMSQIKYK.K
  7.8        10         693        K.LTYSFRNEEEK.I
  7.7        10         690        R.FFPCLSWMSLK.W
Top scoring peptide matches to query 1332
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 315053.8 FinneganScanNumber: 3085
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1333
Elution from: 32.70 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 321563.1 FinneganScanNumber: 2190
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.3       5.8      -13.29        -.MRSGGGCSGSLSLR.G
  9.3       7.2         694        -.MAAGGMEGLKTEGR.A
  4.7        21        9.48        K.YEMMKEHERR.E
  4.1        24         711        -.MGATWTVWNDAR.E
  3.7        26         686        -.MENKSNCKSGIR.G
  3.1        30        3.10        K.SSDSDVSDVSAISR.T
  0.1        61         694        R.MGDAIGISQASMSR.C
Top scoring peptide matches to query 1334
Elution from: 32.70 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1272346.9 FinneganScanNumber: 2189
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.2        17      -13.90        K.FFTDSVNIMHAK.W
  3.9        30         718        K.YEMMKEHERR.E
  3.7        31         695        -.MRSGGGCSGSLSLR.G
  3.4        34         718        K.YEMMKEHERR.E
  2.2        44         719        R.LEEQNEEMMKK.V
  2.2        44         719        R.LEEQNEEMMKK.V
  1.8        48      -10.74        R.ALMDMMGGVLEVK.K
  1.2        56         724        K.ICLENCAEIMR.L
Top scoring peptide matches to query 1335
Elution from: 32.73 to 36.68 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 336723.6 FinneganScanNumber: 2192
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.8        14       -7.03        R.APTGCHGESRVTR.E
  6.7        14       -9.83        -.MENQLWHNTVR.C
  5.4        19         707        R.SIRPDNMSEYSK.Q
  5.3        19        1.19        R.KDMVDMMVSSIR.N
  5.3        19        1.19        R.KDMVDMMVSSIR.N
  4.4        23        10.6        R.SGHAGASAGCGRPSR.G
  3.6        28      -19.60        K.GFGMTLKGPNDFK.L
  3.4        29       -8.87        K.SEINKEEMYIR.Y
  2.9        33         714        R.LYGMNEEGWRR.A
  2.7        35         696        -.XGAGGAAGAGTGGAGPAGR.L
Top scoring peptide matches to query 1336
Elution from: 29.34 to 33.32 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 517334.1 FinneganScanNumber: 1906
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 28.2      0.18      -12.58        K.QMVGGQQLPALAAK.S
 10.9       9.6      -10.22        R.GYPGIPGPKGESIR.G
 10.9       9.6        18.0        K.ENMLKYPELYK.T
 10.9       9.6       -4.71        K.MVQIKFSKDTSK.K
 10.5        10         721        K.CGRTFSQKSSLR.E
 10.2        11       -8.00        K.DMKQGLAKLMHR.M
  9.9        12      -12.57        -.MALDSTIAHLSLR.N
  6.3        28         723        M.AAAACGTKAMALFK.R
  5.5        33        7.75        K.LMLESQLMFRK.M
  5.4        34      -12.58        -.MAAVVLPPTAASQR.E
Top scoring peptide matches to query 1337
Elution from: 29.34 to 33.34 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 380099.8 FinneganScanNumber: 1907
Score greater than 29 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 29.0      0.16         690        K.QMVGGQQLPALAAK.S
 15.1       3.8         721        K.ENMLKYPELYK.T
 15.1       3.8         698        K.MVQIKFSKDTSK.K
 12.3       7.2      -15.25        K.ANGVLEARQLAMR.I
 11.1       9.4         695        K.GNQLREQNLLDK.A
 10.7        10         693        R.GYPGIPGPKGESIR.G
  9.8        13        10.2        -.MARAALSAAPSNPR.L
  9.4        14       -5.03        R.LNLNEVEKQWR.L
  9.3        14        0.47        -.MDPQRSPLLEVK.G
  8.4        18        10.2        R.GACEVRPLGNLSR.N
Top scoring peptide matches to query 1338
Elution from: 22.73 to 26.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1655863.6 FinneganScanNumber: 1300
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 47.7    0.0017       -1.14    1   IPI00301263 R.IIAHAQLLEQHR.G
 14.8       3.2      -18.77                    K.ILLLIDNAPGHPR.A
 12.1       5.9      -18.76                    R.LLVAKAYRHTEK.V
 10.8         8         722                    R.IFNSIGNLERHK.L
  9.6        11        12.2                    K.LLVLASDGGLMPAR.A
  9.3        11      -10.90                    K.EPPTPIAPPQLLR.A
  9.1        12        8.60                    K.NLANRVHSPHKR.L
  7.7        17        11.3                    R.LLAFGVSLRHCR.W
  7.6        17       -1.15                    R.KPPGDRPPAAGPLR.L
  6.8        20        9.52                    R.LLRGDTDVRVER.K
Top scoring peptide matches to query 1339
Elution from: 22.75 to 26.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1655863.6 FinneganScanNumber: 1305
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 58.9   0.00012       -1.14    1   IPI00301263 R.IIAHAQLLEQHR.G
 13.5       4.3        14.6                    R.LNPVVKVEPDYR.L
 13.3       4.6        12.2                    K.LLVLASDGGLMPAR.A
 13.1       4.7       -0.20                    K.NLLKDLEDSLLR.E
 10.4       8.8      -18.77                    K.ILLLIDNAPGHPR.A
 10.3       9.1        8.60                    K.NLANRVHSPHKR.L
 10.0       9.6         697                    K.LLELQEVDSLLR.G
  9.9       9.9         694                    R.KPLREKMKPER.C
  9.4        11        11.3                    R.LLAFGVSLRHCR.W
  8.8        13         715                    K.VTTVVATLGQGPER.S
Top scoring peptide matches to query 1340
Elution from: 22.71 to 26.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1655863.6 FinneganScanNumber: 1298
Score greater than 31 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 37.8     0.016       -1.14    1   IPI00301263 R.IIAHAQLLEQHR.G
 16.4       2.2      -18.77                    K.ILLLIDNAPGHPR.A
 15.6       2.6       -8.08                    R.KPRTLLPSTSNSK.M
 13.0       4.9      -10.90                    K.EPPTPIAPPQLLR.A
 12.7       5.2       -1.15                    R.KPPGDRPPAAGPLR.L
 12.3       5.7        14.6                    R.LNPVVKVEPDYR.L
 11.5       6.9       -0.20                    K.LILKKEDELGDR.S
 10.3       9.1         723                    R.KVLPEDSAQALEK.L
 10.2       9.3        11.3                    R.LLAFGVSLRHCR.W
  8.8        13        12.2                    K.LLVLASDGGLMPAR.A
Top scoring peptide matches to query 1341
Elution from: 22.75 to 26.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 784806.6 FinneganScanNumber: 1301
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 60.4   8.8e-05        0.48    1   IPI00301263 R.IIAHAQLLEQHR.G
 11.7       6.5        10.2                    K.NLANRVHSPHKR.L
  9.2        12      -14.31                    K.IRDLIAIERSSR.L
  8.6        13      -19.50                    R.ILPKPTRKSCTK.N
  6.6        21        18.1                    R.GSFSRVVRVEHR.A
  5.8        25         711                    K.MLPLLEVAEKER.E
  5.8        25        16.2                    K.SHTDQLVLIFAGK.I
  5.8        26         711                    R.GNGTSMISLIIPPK.D
  5.3        28         696                    R.LIIWGVLELEDK.Y
  5.2        30         688                    -.VVIPPQPPTTGPPK.K
Top scoring peptide matches to query 1342
Elution from: 22.75 to 26.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 784806.6 FinneganScanNumber: 1303
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 66.0   2.4e-05        0.48    1   IPI00301263 R.IIAHAQLLEQHR.G
 15.6       2.7         718                    K.IVLPMHSFAQLR.D
 11.1       7.5        16.2                    K.SHTDQLVLIFAGK.I
  9.6        11        10.2                    K.NLANRVHSPHKR.L
  9.1        12      -19.50                    R.ILPKPTRKSCTK.N
  8.0        15       -6.45                    R.TALDIKIAKGGADR.Q
  6.9        20        15.7                    R.RAPAGGSLGRALMR.H
  6.3        22         709                    R.LVLGGRDDVSAGLR.G
  5.3        29        11.2                    R.LLRGDTDVRVER.K
  4.8        32        12.9                    R.LLAFGVSLRHCR.W
Top scoring peptide matches to query 1343
Elution from: 37.78 to 41.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 458470.9 FinneganScanNumber: 2891
Score greater than 17 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.2       6.3       -3.40        R.RTVTSILYPLLR.L
  4.2       7.8         705        R.VKFAMDLPLLKR.A
  0.7        18         697        -.MKIRPGFSLLLR.L
  0.1        20         720        K.HPPNRRVLQSVK.R
Top scoring peptide matches to query 1344
Elution from: 22.62 to 26.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 417113.8 FinneganScanNumber: 1290
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9        13         691        M.PWQTGTLGTSYAR.Q
  8.0        16         704        K.IGQARNTLMDMR.L
  6.5        23        1.09        K.QMVSGAKDLVCSK.M
  6.2        24         688        R.LPLHAATAEPDMR.L
  5.9        26       -6.72        R.VASVLGTMEMGRR.M
  4.5        36        15.8        R.DEMLRMYHALK.E
  4.5        36         714        -.MAENKGLGYPDAR.F
  3.9        42         711        R.EYRTLGGGGGGGSGGR.R
  2.5        57      -19.51        K.DEKELRTSFWK.S
  2.4        58         686        -.XAGTVTVQQMLSR.G
Top scoring peptide matches to query 1345
Elution from: 22.65 to 26.64 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 417113.8 FinneganScanNumber: 1293
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.2       7.6         711        R.EYRTLGGGGGGGSGGR.R
 10.2       9.6         698        R.SRVGFGENGACRK.E
  9.6        11        14.0        R.KGTDDSMTLQSQK.F
  7.9        16         699        R.SWALYEDEGVIR.C
  6.7        22       -1.68        EPWMMEKKLSK
  6.7        22      -11.84        -.MQAMIRAMETLK.I
  6.6        22         711        K.EKQEDIMNRMK.K
  6.2        25       -1.08        R.ESATADAGYAILEK.K
  6.0        25        3.43        R.VFQSGQGMGIKASE.-
  5.1        31      -11.69        R.YWEQEVSELKK.D
Top scoring peptide matches to query 1346
Elution from: 22.62 to 26.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 417113.8 FinneganScanNumber: 1289
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.1         2         711        K.EKQEDIMNRMK.K
 13.8       4.2         688        R.LPLHAATAEPDMR.L
 13.2       4.8      -12.19        -.MEGAGAGSGFRKVR.A
 13.0       5.1       -4.35        R.QENLRYNNMLK.Q
 11.1       7.9        8.93        R.AAEIMETSIQAMK.R
  6.9        21       -4.37        R.ALEMHLNSHSGVK.M
  4.8        33         681        -.MSSRRSSLSPWK.C
  4.8        34      -16.70        K.EENSSGLKYKAGR.L
  3.3        47      -14.06        K.TMVDELFAEIVR.Q
  3.2        48        7.97        R.VGDTKHGMMKFR.E
Top scoring peptide matches to query 1347
Elution from: 22.60 to 26.61 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 782950.6 FinneganScanNumber: 1288
Score greater than 32 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.4      0.72       -7.07        K.FENSISRLTEDK.I
 20.8      0.84      -17.69        K.KQLFSEGGNFSPK.E
 18.4       1.5        15.9        R.KENSMDTASQAIK.-
 16.7       2.2         700        R.SRVGFGENGACRK.E
 16.7       2.2      -10.01        -.MQAMIRAMETLK.I
 16.0       2.5      -10.01        -.MQAMIRAMETLK.I
 15.9       2.6        13.1        K.EEWEKMKVSEK.I
 15.0       3.2         716        -.MAENKGLGYPDAR.F
 14.7       3.5        5.28        R.EQGKEQAMFDKK.V
 14.2       3.9      -17.36        R.MFIVISEPDMIK.Q
Top scoring peptide matches to query 1348
Elution from: 22.55 to 26.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 782950.6 FinneganScanNumber: 1280
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.8      0.53        15.9        R.KENSMDTASQAIK.-
 20.0         1        13.1        R.EPLPPAPAENEMK.Y
 18.6       1.4      -14.87        K.EENSSGLKYKAGR.L
 16.6       2.2        13.1        K.EEWEKMKVSEK.I
 15.6       2.8      -14.55        K.MKEPTTKAEMLK.I
 13.7       4.3        0.75        R.ESKFIKDADEEK.A
 13.0         5      -10.01        -.MQAMIRAMETLK.I
 13.0         5      -10.01        -.MQAMIRAMETLK.I
 12.6       5.6         700        R.SRVGFGENGACRK.E
 11.4       7.3       -7.09        K.ESEVTVGGLEPGHK.Y
Top scoring peptide matches to query 1349
Elution from: 30.46 to 34.46 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 484136.4 FinneganScanNumber: 1994
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.5        14         709        R.GHLVLTPFGIGDGR.A
  7.0        16         701        R.HTPKQPLPHIDR.E
  5.6        22         712        M.ASAGPNRPEISLAR.N
  5.2        24         712        R.SSRKVVEHSNPAK.Y
  4.7        27         704        R.SVPRNIPRNTER.L
  4.5        28         679        R.AQXSLPRAAALER.X
  4.4        29         694        K.LVPGLREQELER.E
  4.3        29         686        R.TSNLVKGAKLHDR.E
  3.1        38         696        R.RLGRGAGQGNRPVT.-
  2.7        42        9.80        K.TEKIESEIHVVR.G
Top scoring peptide matches to query 1350
Elution from: 30.37 to 34.36 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 718807.3 FinneganScanNumber: 1981
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       5.3      -17.32        R.QMSLLLRRPPGR.E
  8.1        12        10.6        K.QLMMSLLRLYR.F
  7.2        15         678        R.ELLPGLKVIDGER.V
  7.1        15         708        R.CIVSHLQELLAR.G
  6.4        18        18.1        K.VGKWENHTLSLR.H
  6.3        18      -14.05        R.GALLPLSIRDGEAK.Q
  5.7        21         701        K.TYIQTELPFKAK.T
  5.6        21       -4.51        R.LMLELGFSKVFR.V
  5.1        24        18.4        K.AFMSKTPKAMAIK.A
  4.9        25         693        K.VSPGFNSLSFKKK.I
Top scoring peptide matches to query 1351
Elution from: 30.31 to 34.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 718807.3 FinneganScanNumber: 1976
Score greater than 22 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.0       6.1        13.1        R.RAEAAGRQSQPLR.D
 10.4         7        8.43        R.QLDTVNFFLKSK.E
  8.8        10        15.8        K.AHRLCVNTVEIK.E
  7.6        13        10.6        K.QLMMSLLRLYR.F
  6.3        18         685        R.GVAFLPHQTVTIR.F
  5.1        24         696        R.HSEIIKLENSIR.E
  4.6        27         703        K.THLPSWKAGTGRK.S
  4.5        27         706        R.MLDILAEYLTIK.H
  3.8        32        0.14        R.VHLGRRVVMNSR.E
  1.9        49       -4.39        R.RRSPAPSLTTPTR.A
Top scoring peptide matches to query 1352
Elution from: 37.51 to 41.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6198802.9 FinneganScanNumber: 2850
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4        11         678        K.VKVAVRVRPMNR.R
  6.6        14         703        -.MRVGGVGRVPQIR.A
  5.8        16        7.69        K.GQEGAASKVLGRLR.A
  4.5        22         681        R.VRKGGVDPTASLLK.G
  4.0        25         690        R.RREAHLRPHLR.G
  1.3        47         681        R.IKTTTSPSKPPKR.A
  0.8        52         707        K.EIQNAVNGVKQIK.T
  0.8        53         688        R.LVWELRERLAR.M
  0.6        55         715        R.KEKGDPLNIAIDK.M
  0.2        60         689        R.TQTSTLLTPIPLR.W
Top scoring peptide matches to query 1353
Elution from: 37.54 to 41.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6177840.6 FinneganScanNumber: 2855
Score greater than 26 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.0       2.5       -1.99        R.LSVEDAVKVGLVGR.E
 12.7       3.4       -1.97        ELKATGNIVEVLR
  8.2       9.6         689        R.GIPTREDLSIVLK.G
  5.5        18         681        R.IKTTTSPSKPPKR.A
  5.1        20         715        K.IENEELNVLVLR.L
  5.1        20         707        K.KLLQEDNTPVRK.L
  4.6        22      -17.56        R.EITAALSRVLGRR.R
  2.5        36        2.57        K.LAAMPALRSINLR.F
  2.2        38         711        K.LMPVSAQTPKGRR.L
  2.1        39        7.69        K.GQEGAASKVLGRLR.A
Top scoring peptide matches to query 1354
Elution from: 37.68 to 41.64 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6177840.6 FinneganScanNumber: 2875
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.9       8.1         715        R.LKDDVPEEVKLR.R
  8.2       9.6         689        R.TQTSTLLTPIPLR.W
  7.7        11         688        K.HGLLQPQPPGLKR.S
  6.5        14        15.5        K.ASLQVQLDAVNKR.L
  5.0        20        15.5        M.INQLTGTIQVAQR.I
  2.9        32       -9.77        K.ILIVGRESGTIQR.Y
  1.9        40         688        R.LVWELRERLAR.M
  1.9        40       -0.12        R.QLRRGSLGGALTGR.Y
  1.7        42         681        K.KAANDSLLIGGLLR.I
  1.6        44        14.6        R.GAAAALSRARVWGR.L
Top scoring peptide matches to query 1355
Elution from: 37.68 to 41.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2002753.4 FinneganScanNumber: 2876
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.6        17       -0.22        R.GGTAILLLTGLEQR.A
Top scoring peptide matches to query 1356
Elution from: 37.61 to 41.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2002753.4 FinneganScanNumber: 2868
Score greater than 14 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.4        28       -8.92        K.KQPPRAHNLKPR.D
  1.0        48         691        K.LLRTLSSPTEPVK.R
Top scoring peptide matches to query 1357
Elution from: 41.11 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1622449.6 FinneganScanNumber: 3165
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1358
Elution from: 41.73 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 648297.8 FinneganScanNumber: 3234
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1359
Elution from: 41.11 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1857511.8 FinneganScanNumber: 3166
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1360
Elution from: 41.73 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 871174.8 FinneganScanNumber: 3233
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1361
Elution from: 35.82 to 39.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6148628.3 FinneganScanNumber: 2562
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.7       0.9      -17.05        R.TTVTMSMHLLPKA.-
 20.7       0.9      -17.05        R.TTVTMSMHLLPKA.-
 11.3       7.9         708        K.ARSLDEGASQDAPK.L
  9.0        13        10.5        -.MAVTLDKDAYYR.R
  8.0        17        5.48        R.DSMQGGAGKSPAAIR.E
  7.5        19        0.96        K.DSAQDDQAKQVLK.G
  7.1        21        17.7        -.MALGYPMAMGLFK.G
  6.8        22        0.97        K.NSKNDSSVADLAPK.G
  6.1        26        17.4        R.GWADSPGSGSRXGR.Y
  5.2        32        7.79        R.SSSGTPVNFGTHVR.F
Top scoring peptide matches to query 1362
Elution from: 35.61 to 39.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6148628.3 FinneganScanNumber: 2524
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.4       1.2         713        K.SDAPTSSSFFTGLK.S
 13.7       4.5      -17.05        R.TTVTMSMHLLPKA.-
 13.7       4.5      -17.05        R.TTVTMSMHLLPKA.-
  6.3        25         708        K.ARSLDEGASQDAPK.L
  4.9        34       -5.08        K.SMWPLPSATQRR.A
  4.8        35        17.8        -.MAPSHLSVREMR.E
  4.8        36        12.8        R.SDLKWQWEPEK.E
  4.3        40        0.96        K.DSAQDDQAKQVLK.G
  3.8        45       -9.62        R.HQSFVLVGETGSGK.T
  3.6        47       -7.41        R.MTSPSRRPIPCK.L
Top scoring peptide matches to query 1363
Elution from: 35.53 to 39.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6148628.3 FinneganScanNumber: 2509
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.2       5.1      -17.05        R.TTVTMSMHLLPKA.-
 12.6       5.9      -17.05        R.TTVTMSMHLLPKA.-
  9.6        12         698        M.SISSALAMVFMGAK.G
  8.0        17       -2.43        K.MALFMVEGTKFR.S
  7.5        19         703        K.SLSSKKSYECQK.C
  6.8        22         708        K.ARSLDEGASQDAPK.L
  6.4        24         707        R.SAENAYGGHRGLGR.Y
  6.0        27       -5.08        R.FQKLHLACGSER.L
  5.8        28        0.96        K.DSAQDDQAKQVLK.G
  5.2        32      -12.86        K.GHRRTYVGAMPGK.I
Top scoring peptide matches to query 1364
Elution from: 35.53 to 39.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6148628.3 FinneganScanNumber: 2508
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 25.4       0.3      -17.05        R.TTVTMSMHLLPKA.-
 25.4       0.3      -17.05        R.TTVTMSMHLLPKA.-
 12.6       5.9        0.35        K.MCSLAVVNLGTHK.F
  8.7        14         695        K.LAAPRAGEQGEAMK.Q
  8.2        16       -6.81        R.TKSSDSDLSPPRR.S
  7.4        19         676        R.AQMKGFPPSRGPR.D
  7.1        21         710        K.NSTVMARAEYFR.N
  5.9        27      -12.86        K.GHRRTYVGAMPGK.I
  5.3        32         715        KGPPLDGTMCAPGK
  4.4        39         703        R.SQGPTPTLNTGPMK.D
Top scoring peptide matches to query 1365
Elution from: 14.26 to 18.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 415258.6 FinneganScanNumber: 721
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.6       3.3         708        R.IIYSAKLSFLYK.G
  4.2        11        1.54        -.MKIRPGFSLLLR.L
  2.3        18         703        R.GPPGTGLTVPPALLR.A
  0.6        26       -2.97        K.LQSTPKYQKLLK.E
  0.3        28       -2.97        R.DLPKLTSLYLRK.M
Top scoring peptide matches to query 1366
Elution from: 14.23 to 18.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 415258.6 FinneganScanNumber: 720
Score greater than 17 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.0       7.4         703        R.GPPGTGLTVPPALLR.A
  3.9        12        14.4        R.GAAQLSILVKGFSR.Q
  2.5        17         708        R.IIYSAKLSFLYK.G
  2.4        17       -2.97        K.IIITINNFKKDK.K
  1.4        22         688        K.LARSPARISPHIK.D
  0.9        24      -10.75        K.ILANGLLQLGHGLK.D
  0.2        29         703        K.ARLTVNVLPSFTK.T
Top scoring peptide matches to query 1367
Elution from: 14.26 to 18.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 337561.8 FinneganScanNumber: 723
Score greater than 18 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.0       5.1         711        R.MQENLVKTLLLK.E
  5.4       7.4        9.53        R.KNSQTLTSILTIK.S
  5.0       7.9        16.4        R.GLNELQRFTKLK.S
  4.9       8.2         705        K.ARLTVNVLPSFTK.T
  4.8       8.3        11.3        R.VMQLALFQGIAKK.H
  4.8       8.4        16.4        K.TYAIKRAALAPGSK.G
  4.4       9.3         713        K.TLEVLKGPVSFQK.S
  4.2       9.6        6.74        R.VGLVLLLQDYSVK.K
  3.0        13        16.4        R.AQVKRFTQDLLK.L
  2.8        13        19.0        K.QFDLCLLLALIK.H
Top scoring peptide matches to query 1368
Elution from: 27.31 to 31.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1503428.7 FinneganScanNumber: 1737
Score greater than 25 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 55.3   0.00012        0.65    1   IPI00301263 VMASMFYEVSTR
  9.6       4.6      -19.34                    K.MFLSSVGSGHGETK.A
  7.2       7.9         684                    -.MQWSKEEEAAAR.K
  6.3       9.7         691                    -.MDCGSVGGQRTQR.L
  5.4        12         707                    K.TNQGSMENLCPGK.A
  5.2        12         677                    K.MVEDGQSGDLEKK.A
  5.1        13         686                    R.NWYSDADVPASAR.Q
  3.5        18         707                    R.SPRPSSSSDSDSDK.S
  2.1        26        19.8                    M.CASRDDWRCAR.S
  1.5        29        15.3                    K.DMVGSPAHDTNHR.G
Top scoring peptide matches to query 1369
Elution from: 27.26 to 31.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1503428.7 FinneganScanNumber: 1733
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 52.0   0.00026        0.65    1   IPI00301263 VMASMFYEVSTR
  4.0        17         684                    -.MQWSKEEEAAAR.K
  3.5        19        15.7                    -.XMMNDSCQNLPK.I
  3.4        19         682                    R.VMSRGEGDCDVVK.S
  3.0        21         695                    K.QMEEEKQQTER.V
  3.0        21         695                    K.TQSSDGKAQMQSPA.-
  1.5        29      -14.83                    K.VMGHSSLNCYIR.V
Top scoring peptide matches to query 1370
Elution from: 29.19 to 33.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1361613.9 FinneganScanNumber: 1891
Score greater than 23 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.6         4         702        K.IGTKSKDLPSGPEK.H
  9.9       9.5         706        -.MKSTADLHQKLGK.A
  8.5        13         706        K.QQEKKMTLLHGK.T
  7.1        18        13.2        K.LLVPEIDEVMRK.V
  6.9        19         681        K.SLLKALHMKANSK.F
  6.9        19         689        K.MQILEGLGLNLQK.S
  6.6        20         704        R.DRGLVRPGSSREK.V
  6.6        20         676        R.REFTVSLHLARK.L
  6.2        22         677        K.LDITAEILAVRDK.Q
  6.1        23         691        K.EELNIVKLYAHK.G
Top scoring peptide matches to query 1371
Elution from: 29.32 to 33.31 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1361613.9 FinneganScanNumber: 1902
Score greater than 29 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 21.0      0.74       -6.73        IRAELKEIETQK
 14.7       3.1         694        R.QLNEVENNIKKK.A
 14.0       3.7         679        -.MAAVTPRLFLPPK.S
 13.0       4.6       -6.74        K.LEVELREVTKNK.E
 12.7       4.9         691        K.ILNLKSDEHIFK.F
 12.2       5.6        2.81        R.GLRRTSSSIDLPR.K
 10.4       8.4         689        K.MLPKLEEELKAR.I
  9.3        11        10.5        R.GDAKILDNRISQK.T
  7.7        16         709        R.QEERNKAFIPPK.E
  7.5        16        10.5        M.PERNSTSVKNVVK.A
Top scoring peptide matches to query 1372
Elution from: 29.25 to 33.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1361613.9 FinneganScanNumber: 1896
Score greater than 26 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.0       1.5       -6.73        IRAELKEIETQK
 12.2       5.5       -6.74        K.LEVELREVTKNK.E
  8.4        13         689        K.MLPKLEEELKAR.I
  7.9        15        0.96        R.LLDTKNPSLDTIK.M
  7.7        16         704        K.VSGKNGSAAREKPR.R
  6.3        22      -17.21        K.LKVEPGYPKSALR.D
  5.7        25         709        R.QEERNKAFIPPK.E
  4.0        36        15.0        K.GCGTVLLSGPRKGR.E
  4.0        37         693        R.AHGHGREAVVAKPK.H
  3.5        41         691        K.ILNLKSDEHIFK.F
Top scoring peptide matches to query 1373
Elution from: 25.89 to 29.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2866850.1 FinneganScanNumber: 1603
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 99.7   9.5e-09        0.98    1   IPI00301263 R.VNEISVEVDSDPR.A
 19.4         1        10.4                    R.DVGMVDSDPWLPK.V
 14.3       3.3        5.47                    R.DNLIGEETKHMR.Q
 14.3       3.3         695                    -.MPTWGARPASPDR.F
 10.1       8.5        0.98                    R.DPEVVNDESSLVR.H
  9.0        11         676                    K.ADTPSLGEGPEKTR.S
  8.8        11      -17.20                    R.TNTPVKEDWNVR.I
  8.7        12      -17.22                    R.SADVLGVADGVGGWR.D
  8.5        12       -6.72                    K.NIALDKTDDSNPR.E
  8.3        13         688                    R.GRAAWAVGPACDAR.R
Top scoring peptide matches to query 1374
Elution from: 25.87 to 29.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2866850.1 FinneganScanNumber: 1599
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 88.8   1.2e-07        0.98    1   IPI00301263 R.VNEISVEVDSDPR.A
 18.0       1.4         695                    -.MPTWGARPASPDR.F
 15.4       2.5        5.47                    R.DNLIGEETKHMR.Q
 13.6       3.8       -6.72                    K.NIALDKTDDSNPR.E
 13.6       3.9      -11.79                    K.QSGSPEEMVLLPR.Q
 11.8       5.9        0.08                    R.KAAAAAGEAGAWGGDR.E
  9.8       9.2        0.07                    K.SQSKWGPTSNNPR.G
  8.4        13        19.9                    K.DGVSPCRPGWSAVA.-
  7.0        17      -11.79                    K.KVETPEGEVMSPR.Q
  7.0        18        10.4                    R.DVGMVDSDPWLPK.V
Top scoring peptide matches to query 1375
Elution from: 25.98 to 29.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2866850.1 FinneganScanNumber: 1614
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 95.6   2.4e-08        0.98    1   IPI00301263 R.VNEISVEVDSDPR.A
 18.2       1.3        19.9                    K.DGVSPCRPGWSAVA.-
 17.7       1.5      -17.22                    R.SADVLGVADGVGGWR.D
 14.1       3.4        5.47                    R.DNLIGEETKHMR.Q
 13.8       3.6      -11.79                    K.QSGSPEEMVLLPR.Q
 10.4         8      -15.04                    R.GTQGLPMTMGPRGR.H
  9.7       9.5      -11.79                    K.KVETPEGEVMSPR.Q
  9.5       9.9       -6.72                    K.NIALDKTDDSNPR.E
  8.9        11        17.3                    R.DRDTPHSDFRGR.H
  8.4        13        0.98                    R.DPEVVNDESSLVR.H
Top scoring peptide matches to query 1376
Elution from: 25.85 to 29.85 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2866850.1 FinneganScanNumber: 1596
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 77.9   1.4e-06        0.98    1   IPI00301263 R.VNEISVEVDSDPR.A
 17.7       1.5         695                    -.MPTWGARPASPDR.F
 16.2       2.1       -5.00                    R.XAAQTWPATAAAPR.A
 15.5       2.5      -15.04                    R.GTQGLPMTMGPRGR.H
 14.3       3.3        17.3                    R.DRDTPHSDFRGR.H
 13.0       4.4        0.08                    R.KAAAAAGEAGAWGGDR.E
 12.5       4.9         678                    R.DNPRASRTSSPNR.A
 12.3       5.2       -7.33                    R.AVTVEMVAHLCGR.F
 12.2       5.3        19.9                    K.DGVSPCRPGWSAVA.-
 10.7       7.5      -11.79                    K.KVETPEGEVMSPR.Q
Top scoring peptide matches to query 1377
Elution from: 37.71 to 41.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 865969.4 FinneganScanNumber: 2882
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.0         1        12.7        K.TAFTIPAIKGVGQR.Y
  6.9        11         688        K.NELVRQLVAFIR.K
  6.5        12         699        R.SLRTSSPSAALVLR.H
  5.4        15       -9.48        K.KTSNLSVLRTALR.Y
  4.8        17         706        R.TTLGLLPTLTAGSGR.A
  2.9        27         699        R.REIQRLETLATK.E
  1.6        36         703        -.MEGLAVRLLRGSR.L
  1.3        39         699        K.KTSGNQITLQVIR.K
  1.2        39         698        R.AARAIQGAFRQLR.A
  0.1        50         704        K.SISVVLTAPEKWK.R
Top scoring peptide matches to query 1378
Elution from: 37.87 to 41.86 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 530259.4 FinneganScanNumber: 2911
Score greater than 14 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.1        31        2.28        K.KELIINEILVMK.E
  1.3        37         708        K.QSREIVLEDLKK.L
  1.2        38        19.5        R.LALAQVLAVMGQTK.E
Top scoring peptide matches to query 1379
Elution from: 20.50 to 24.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 228760.7 FinneganScanNumber: 1092
Score greater than 28 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 24.9      0.22        1.04    2+  IPI00011654 EVDEQMLNVQNK
 13.5         3      -16.15                    K.EETEQLLMVENK.E
 10.3       6.2      -16.15                    R.IQDLETENMELK.N
  8.5       9.5         675                    R.NLEPCSSAVDTLR.S
  6.8        14         692                    R.GDSGSTPMPRDGLR.N
  5.8        18      -17.09                    K.RWQQDMSTSVPK.L
  5.4        19         684                    K.NLSFMDAMNKFK.W
  4.4        24        6.09                    K.TGTEAEAADSGAVGAR.R
  4.1        26         703                    K.EENLEEEEALEK.E
  4.0        27      -12.04                    FQVPDSEGGRAGSR
Top scoring peptide matches to query 1380
Elution from: 20.08 to 24.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 357428.3 FinneganScanNumber: 1061
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.8        24      -17.18        R.LQEIHPECGPCK.T
Top scoring peptide matches to query 1381
Elution from: 20.08 to 24.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 357428.3 FinneganScanNumber: 1059
Score greater than 18 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.0       7.3       -9.52        R.VWDLKDDGNMMK.V
  4.8       9.6      -16.27        R.MLDQTLLDLNEM.-
  3.8        12      -17.18        R.LQEIHPECGPCK.T
  0.2        28       -4.47        K.NQDVCALNENYK.N
Top scoring peptide matches to query 1382
Elution from: 22.50 to 26.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1488920.4 FinneganScanNumber: 1274
Score greater than 17 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.8         7      -19.08        K.WDSIPNTEESYK.C
Top scoring peptide matches to query 1383
Elution from: 22.42 to 26.42 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1488920.4 FinneganScanNumber: 1265
Score greater than 13 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.2        16         695        K.EEEQLSYDDPDK.K
  0.8        17         677        K.EAMIQCSLEACR.I
  0.2        20         667        K.NQDVCALNENYK.N
Top scoring peptide matches to query 1384
Elution from: 22.42 to 26.40 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1488920.4 FinneganScanNumber: 1264
Score greater than 15 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.4       6.1      -10.21        -.MSGGWMAQVGAWR.T
  2.7        11         666        R.SNAYHFPDEPYK.D
  1.4        15         668        K.EMMKHAWNNYK.G
  1.4        15         668        K.EMMKHAWNNYK.G
  0.5        19         685        K.EEMDDQDKDKAK.G
Top scoring peptide matches to query 1385
Elution from: 35.36 to 39.35 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 459379.7 FinneganScanNumber: 2484
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.8      0.83         665        R.SNLSHLLDLMGSGK.E
 12.0       6.3        12.5        R.SRTRPWCGEAPR.K
 11.9       6.4        3.03        K.MGWKEGHGLGSLGK.G
 11.7       6.8        1.34        K.NSDVLQSPLDSAAR.D
 11.2       7.7      -18.94        R.SLSSCLRPAPXASR.T
 11.1       7.8         664        -.MAAGAGAGSAPRWLR.A
 10.7       8.6       -9.02        R.GKWSKSVTSSSYR.R
 10.2       9.5         692        K.ETSLDHPYEKPR.K
  8.5        14        16.0        R.LQMELMEYKAGK.R
  8.4        14       -9.94        K.SHGRIRFYHDGK.C
Top scoring peptide matches to query 1386
Elution from: 17.23 to 21.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 310101.4 FinneganScanNumber: 883
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.9       2.2        2.30        K.VKGGCGQRGTYHR.S
 16.4       2.4         679        K.IEETMNQASPARK.L
 13.5       4.7       -7.12        K.FGQRSPNAIPMNK.A
 12.1       6.6        3.23        R.MRQIASNSPGSSPK.T
 10.0        11        8.23        R.RDSSGGTKDGDRPK.I
  9.9        11        12.7        K.AKSSGAGPSRCGQGR.G
  9.3        12        15.3        K.RMSSEGPPRMSPK.A
  9.0        13         684        R.EVPSSGERGEKGSR.K
  8.5        15        3.24        R.CSGIASAAAAAVEAAR.G
  7.2        20        3.21        K.GVGAGCNTKEVIDR.L
Top scoring peptide matches to query 1387
Elution from: 36.79 to 40.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3658162.9 FinneganScanNumber: 2725
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2        17         673        -.MMVLKVEELVTGK.K
  5.2        33         697        R.ADLQSTFSGGRIPK.K
  4.5        38         672        K.KLLEQEKAYQAR.K
  3.6        48        13.2        QTVFIETLIEER
  2.6        60        15.0        R.SPGPLRGVPAGQXDR.E
  2.6        60        7.69        K.KLNTCAMKGGLLR.S
  1.6        75        14.1        K.QGRVSQRWHPAR.E
  1.2        83        5.55        K.LFVDSLEKGKDAR.A
  1.0        87       -9.79        R.QVGMLFLPIKANF.-
  0.6        95        10.9        M.IEDTMTLLSLLGR.I
Top scoring peptide matches to query 1388
Elution from: 41.75 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1048698.4 FinneganScanNumber: 3236
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1389
Elution from: 28.17 to 32.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 931668.4 FinneganScanNumber: 1813
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 41.1     0.007         669   18   IPI00382401 R.KCPSQSEVAGPAPR.L
 22.6      0.49        10.4                    K.AEQGASGSQDPGKPR.V
 18.5       1.3       -4.82                    K.VRMNSYPYLADR.H
 17.3       1.7         665                    K.DSGLESPAAAEAPLR.G
 13.0       4.5         695                    K.MGEYRKMWNPR.E
 12.9       4.6         671                    R.GLTPREFNSYGSR.R
 12.2       5.4         664                    R.RDPSRELWDGPR.S
 10.2       8.6         664                    R.RDEKSHPFTNPR.W
  7.2        17         671                    K.TEHYKTDLHSPR.G
  6.2        21      -15.01                    R.GGGTGGPNHPPAPRGR.T
Top scoring peptide matches to query 1390
Elution from: 28.17 to 32.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 931668.4 FinneganScanNumber: 1812
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 20.4      0.81         671                    R.GLTPREFNSYGSR.R
 11.2       6.8         669   18   IPI00382401 R.KCPSQSEVAGPAPR.L
 10.0       8.9         664                    R.RDPSRELWDGPR.S
  8.9        12         694                    -.MHVETGPNGEQIR.K
  6.6        19         671                    K.TEHYKTDLHSPR.G
  5.2        27         664                    R.RDEKSHPFTNPR.W
  4.3        33         695                    K.MGEYRKMWNPR.E
  3.4        41         665                    K.DSGLESPAAAEAPLR.G
  1.5        63        10.4                    K.AEQGASGSQDPGKPR.V
  1.0        71       -7.10                    -.MSLMTRENLAFR.G
Top scoring peptide matches to query 1391
Elution from: 37.74 to 41.71 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2745092.4 FinneganScanNumber: 2886
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.7       8.7       -5.34        K.NSRTMLLPLLRR.F
  7.4        12         675        R.QSILVLWDINKR.G
  4.9        21         685        K.VLEHSHRPIQLR.K
  4.3        24         695        R.LRLSPSPTSQRSR.G
  1.9        42         669        K.IEDKALILVDSLR.K
  1.7        43         673        -.MSLLLPSTRLPTR.R
  0.1        63         678        R.EIQRQSTLQLLR.K
Top scoring peptide matches to query 1392
Elution from: 37.65 to 41.64 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2745092.4 FinneganScanNumber: 2874
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.3       1.2       -7.15        K.LASIMSKLPLATPK.K
  6.0        16         675        R.QSILVLWDINKR.G
  5.5        18         695        R.TASAPTKSQKPGRR.G
  3.5        28         661        K.KISLDPKTSLLNR.G
  3.1        31        7.07        K.LSLIQFFSKMKK.W
  2.6        35       -2.21        M.DGVVTDLITVGLKR.G
  1.7        43        14.8        K.QETAVRASISKAPK.I
  1.2        48         678        R.GQTVGSVGKVGQVLR.V
  1.2        48         685        R.LQAQSHLHGIKPR.Y
  0.6        56         670        K.LLAMILWLQLDR.L
Top scoring peptide matches to query 1393
Elution from: 37.61 to 41.60 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2745092.4 FinneganScanNumber: 2867
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.6        14        19.1        K.TGVNPAVIMGARRK.A
  6.2        16        17.3        K.LSDGIGVMLPQVLK.G
  6.1        16         678        R.GQTVGSVGKVGQVLR.V
  4.7        22        5.39        K.ELDTVEVLKAIQK.A
  3.4        29         675        R.QSILVLWDINKR.G
  2.1        39      -12.46        K.NLNVVFIVLEIGR.V
  1.9        41         682        K.VRVVAMAQVARER.V
  1.5        45         692        R.GRLPPSPVPPSQPR.G
  1.4        46         695        R.LRLQRTEGLGGER.E
  1.2        48         693        R.LSAVQIIDDLIER.S
Top scoring peptide matches to query 1394
Elution from: 37.92 to 41.90 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 685466.1 FinneganScanNumber: 2918
Score greater than 17 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.1       1.8         670        K.LNVSKALEAALVEK.G
  3.6        26         669        R.LVIAGHLLRSYRS.-
Top scoring peptide matches to query 1395
Elution from: 37.88 to 41.88 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 685466.1 FinneganScanNumber: 2914
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.1        37         687        R.SSTQVRKSPVPLSV.-
Top scoring peptide matches to query 1396
Elution from: 41.58 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 361467.1 FinneganScanNumber: 3214
Score greater than 15 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.1        29        9.57        -.MAEGGGQNHHEVVK.F
  2.2        45         660        R.GLRSQCECLRGR.K
Top scoring peptide matches to query 1397
Elution from: 41.58 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 796784.2 FinneganScanNumber: 3213
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1398
Elution from: 37.81 to 41.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 79212163.2 FinneganScanNumber: 2900
Score greater than 19 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.2        17       -2.87        K.NQQNNKRVIFLK.L
  5.8        19         675        K.VRVVAMAQVARER.V
  5.5        21        13.9        R.LQLPAQPASRHGAR.G
  3.5        33       -4.66        K.ADLLPISASVQFIK.I
  3.4        33      -10.36        R.GLASPPPGGALRPRR.G
  2.9        38        13.9        R.HRVLTSAFSRATR.D
  2.8        38         682        R.APAAPAAPPPPPPPPR.T
  2.2        44         677        K.AFVFKATGFIMLR.N
  2.2        45        12.1        K.AVAAQDPVIYSLVR.G
  0.2        71       -9.45        K.TLILDALRKESSR.H
Top scoring peptide matches to query 1399
Elution from: 24.77 to 28.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 319717.9 FinneganScanNumber: 1494
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.7       2.5         646        K.TVLMLQKENLPGR.R
 11.1         9        1.25        R.NVTDTDILALERR.L
 10.0        12        1.24        K.QSQPVVTASDISKR.K
  9.9        12        1.22        R.LQGVLGGTGDSLGVSR.S
  9.6        13      -18.45        K.SQRMVQNLLSLAR.K
  7.6        20       -7.05        R.ASRKSSHLHVTHR.R
  7.4        21         682        R.KDNDFLRNTVHR.H
  7.1        23       -8.83        K.GRTVAVDWAVAKDK.Y
  6.5        26         675        -.MGERSATMLLLHR.A
  6.5        26         651        -.XPSGSNVDTLLRLR.G
Top scoring peptide matches to query 1400
Elution from: 37.85 to 41.84 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1670797.1 FinneganScanNumber: 2907
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        12         646        M.LSGRLVLGLVSMAGR.V
  1.8        36         661        K.IDAVIVKLEIMER.A
  1.4        40        15.8        K.MRISGIFLTNHIK.W
  0.9        45         658        K.REELSNVLAITRK.V
  0.3        51        9.32        K.TIVMIPDSQKLLR.C
  0.3        51         642        R.LTLKVGSLLGDREK.A
  0.1        54         673        K.EIDLQTSTIKVPGK.W
Top scoring peptide matches to query 1401
Elution from: 37.85 to 41.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1670797.1 FinneganScanNumber: 2903
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.4       7.9        2.00        K.RLKGALMLENLQK.H
  5.7        15         646        M.LSGRLVLGLVSMAGR.V
  5.3        16         642        K.ELTLASKRELLQK.T
  4.7        19         649        K.KAEEAVKIAESILK.E
  2.3        32         656        K.VHKYNLAVTDKLK.M
  1.9        35        18.9        K.HTLVSITEFILEK.N
  1.6        38         670        R.LEVVSRVRQAMPK.N
  1.4        40         661        K.ILSVDGNKITIMPK.H
  0.9        44         658        K.REELSNVLAITRK.V
  0.8        46        9.32        K.TIVMIPDSQKLLR.C
Top scoring peptide matches to query 1402
Elution from: 40.14 to 44.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 662925.9 FinneganScanNumber: 3082
Score greater than 27 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.2       4.1       -0.74        R.TSKRGSLHFIEQM.-
 13.8       5.6         645        R.YDPLGDNTGALVAVK.Q
 10.9        11         673        R.GLCSLAADGLWNQK.I
  9.4        15         659        K.MPRELSRIEEEK.E
  8.9        17       -2.35        K.EELSASSARTQNLK.A
  8.6        19         647        K.ARGNEYQPSNIKR.K
  8.6        19        1.87        K.CSTVSPVSGINTRR.S
  8.1        21         652        K.MQLRGKGSQDPSTK.V
  7.2        26        6.71        -.XDVDQQSSSSRLR.S
  7.1        26      -19.34        R.QGMITLILATDMAR.H
Top scoring peptide matches to query 1403
Elution from: 40.14 to 44.14 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 815458.7 FinneganScanNumber: 3083
Score greater than 19 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.4       5.2        13.3        R.IEAENRALILRDK.D
  5.5        13      -17.68        R.VQQKAAVTLARLSR.D
  5.5        13        1.14        M.AQQNMKVRPVLLK.R
  3.0        23      -13.01        R.VHGPLSLLAPLPAAGK.K
  2.5        25         657        K.IHFTSLKGLIGPEK.L
  2.4        26         659        K.LVPTHTQVPVHRR.Y
  2.2        27        10.6        R.KKDFQHLISSPLK.K
  1.8        30       -3.09        R.IQATEIAKQQGLLK.K
  1.8        30         645        R.ATRVLRVENVQVR.D
  1.5        31         671        K.LXPKIGFPWSEIR.N
Top scoring peptide matches to query 1404
Elution from: 25.81 to 29.81 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 901656.6 FinneganScanNumber: 1591
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.6       3.3      -12.77        R.SLLKETLDISVGLR.D
  8.5       8.7        7.75        -.MQTGPVLQTRKLR.H
  7.4        11         668        K.NPMVETLGTVLQLK.Q
  7.2        12        15.1        R.ASMNQLLRIAVAEK.G
  6.5        14         665        R.SSLRGLAGEIVGEVR.C
  6.3        14         661        R.RGLDPTGTVILLCK.G
  5.5        17         649        R.GASIVEDKLVKDLR.T
  4.5        21       -8.55        K.VLQRMVGNLLSLGK.R
  4.0        24         663        K.GDPVNYILQVLVGR.E
  3.8        25         637        K.SILVMRSIPELLR.G
Top scoring peptide matches to query 1405
Elution from: 25.12 to 29.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4016168.0 FinneganScanNumber: 1540
Score greater than 28 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 61.8   7.1e-05        3.03    1   IPI00301263 R.VLGTSPEAIDSAENR.F
 11.6       7.5         630                    K.SLTRSTMDASVVFK.D
  9.6        12      -11.95                    K.LLACIASRPGQCGR.A
  7.5        20         635                    K.VMGSLMHPSDLRAK.E
  6.0        27         639                    R.TISMGQGQEVHARK.L
  6.0        27        4.18                    R.GGPLMCRGVGDQRR.E
  5.9        28      -16.13                    R.LNVLEAEMSPQRR.V
  4.5        38         632                    K.DVRVSSTCGRPPAR.Y
  4.2        41        3.01                    R.THTTESTPDSLTLR.S
  4.0        43         651                    -.MGVQCVGHSQILGR.T
Top scoring peptide matches to query 1406
Elution from: 25.08 to 29.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4016168.0 FinneganScanNumber: 1534
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 92.4   6.3e-08        3.03    1   IPI00301263 R.VLGTSPEAIDSAENR.F
 14.5       3.8        4.18                    R.RGGPLMCRGVGDQR.R
  8.3        16         630                    R.ACAPGERPNFLGIR.E
  8.3        16         646                    R.LSRMHFHDSQRK.V
  7.6        19        14.4                    -.MRSSYETLGKENK.E
  6.6        24       -0.41                    K.LEQQHSLFTHYR.D
  6.2        26         658                    R.GFFSIQYVCSPPR.T
  5.7        29         630                    K.SLTRSTMDASVVFK.D
  5.6        30        0.01                    -.MAKPEQAADGGVRGR.G
  5.5        31         630                    R.DIGIPFSYTFELR.D
Top scoring peptide matches to query 1407
Elution from: 25.01 to 29.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4016168.0 FinneganScanNumber: 1525
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 93.4     5e-08        3.03    1   IPI00301263 R.VLGTSPEAIDSAENR.F
 14.3       4.1         628                    K.RDNALELSQLENR.I
 14.0       4.3         651                    -.MNPSEMQRKAPPR.R
 10.1        11         651                    -.MGVQCVGHSQILGR.T
  9.8        11         628                    R.EQAQTARDLQELR.G
  9.4        12         647                    R.VMARLEPDAEEAAR.R
  9.3        13         630                    R.ACAPGERPNFLGIR.E
  8.6        15        19.2                    K.NEDVEALQQQQTR.L
  8.4        16         644                    R.MPAARPAPARSCTR.T
  7.4        20       -7.61                    R.AYHSNPKPFRAXR.N
Top scoring peptide matches to query 1408
Elution from: 25.03 to 29.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4016168.0 FinneganScanNumber: 1527
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 68.0   1.7e-05        3.03    1   IPI00301263 R.VLGTSPEAIDSAENR.F
  8.0        17      -11.39                    R.EQLATARATGEQQR.T
  7.6        19       -7.61                    R.AYHSNPKPFRAXR.N
  7.2        21       -4.19                    K.ETRGLVDGGEAVEAR.L
  7.2        21         637                    K.VEMKANNFPINHK.T
  6.7        23         658                    K.LPGSSDPPASASQSTR.I
  5.5        31         642                    K.MGGIKGLFKGGDMSK.N
  5.5        31         651                    -.MNPSEMQRKAPPR.R
  5.0        35        13.6                    R.HGALAELCPPGGSHR.M
  4.4        39        2.05                    R.NPYVKMYFLPDR.S
Top scoring peptide matches to query 1409
Elution from: 28.93 to 32.93 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 306057.1 FinneganScanNumber: 1864
Score greater than 22 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.6      0.41       -6.38        K.DGEPSGHKEFRESS.-
  8.8       3.1      -11.11        K.KGDYQKAYEDGCK.T
  8.0       3.7         642        M.NEGAPGDSDLETEAR.V
  7.3       4.4         650        K.EDHSESSNTENRR.T
  6.8         5         626        K.HGGEDGRNNSGAPHR.E
Top scoring peptide matches to query 1410
Elution from: 40.23 to 44.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 167005.0 FinneganScanNumber: 3092
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1411
Elution from: 38.14 to 42.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3364797.1 FinneganScanNumber: 2948
Score greater than 13 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.3        45        13.4        -.MVLLPRKPVTMTR.V
Top scoring peptide matches to query 1412
Elution from: 37.95 to 41.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3635020.9 FinneganScanNumber: 2923
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4         9        18.1        K.SGLLNMTKIAQGGRK.L
  4.7        17         642        R.GVMLAVDAVIAELKK.Q
Top scoring peptide matches to query 1413
Elution from: 40.23 to 44.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 292170.9 FinneganScanNumber: 3093
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1414
Elution from: 30.40 to 34.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 331623.0 FinneganScanNumber: 1986
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.0        12      -19.77        R.DGSHSLKVSQQRSR.T
  7.2        19         634        K.QLRSDLSSFDMLR.Y
  7.0        19         650        R.FLRGYEQHAYDGK.D
  6.9        20       -8.97        K.AFSQSFNLIHHQR.T
  6.5        22         631        R.SLYHVHMQNWLR.F
  5.6        27         634        R.YTLSVRALEDMNR.E
  4.1        38         616        R.EISSPRIQDAGPASR.D
  4.1        38         639        R.MQKEINALASSTMK.I
  3.4        45       -4.01        -.MGAPLLSPGWGAGAAGR.R
  3.0        48       -1.88        R.DEHQLHKDFFIR.A
Top scoring peptide matches to query 1415
Elution from: 30.40 to 34.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 331623.0 FinneganScanNumber: 1987
Score greater than 20 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.6        14        12.7        R.CYDRDVSLSTGAIK.I
  7.1        19         627        R.SPPGGTHGSLKTSAMR.S
  1.9        63       -1.47        K.SPGQPMRTHTLTSR.N
Top scoring peptide matches to query 1416
Elution from: 28.49 to 32.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 664667.1 FinneganScanNumber: 1830
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 53.1   0.00054        0.79    9   IPI00029446 R.TTVPSGPPMTAILER.C
 19.3       1.3         631                    -.MLRLLTSMVVMSR.E
 17.3       2.1      -13.37                    -.AVCSLRLPSSPDKR.S
 13.3       5.1         633                    R.RFLPQAAGETGPQGR.L
 12.3       6.5      -15.91                    K.VCASVTFKNYIKR.N
 11.7       7.4         622                    K.GVSDIAIGPQVMLER.T
 11.3       8.2        13.4                    R.RPERNYQHSRSR.S
 11.2       8.3         646                    R.AFRPYGLHGGEPGAR.G
 10.9       8.9         640                    R.GDILSARPDEWLGR.C
  9.9        11       -1.63                    K.KGDKGQIGPTGEVGSR.G
Top scoring peptide matches to query 1417
Elution from: 19.08 to 23.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 302428.9 FinneganScanNumber: 999
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.4      0.39       -2.66        -.XYNPFEEEEEDK.E
Top scoring peptide matches to query 1418
Elution from: 19.08 to 23.08 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 302428.9 FinneganScanNumber: 1000
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1419
Elution from: 40.96 to 44.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 527820.7 FinneganScanNumber: 3145
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1420
Elution from: 40.96 to 44.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 527820.7 FinneganScanNumber: 3146
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.7       2.9       -2.86        -.MAEEMVEAAGEDER.E
Top scoring peptide matches to query 1421
Elution from: 40.96 to 44.94 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2198152.8 FinneganScanNumber: 3145
Score greater than 16 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1422
Elution from: 40.96 to 44.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2198152.8 FinneganScanNumber: 3146
Score greater than 16 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.7       1.9         621        -.MAEEMVEAAGEDER.E
Top scoring peptide matches to query 1423
Elution from: 41.00 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2198152.8 FinneganScanNumber: 3154
Score greater than 16 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.0       1.1        12.9        R.CNITPCENMECR.D
Top scoring peptide matches to query 1424
Elution from: 41.00 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2052655.2 FinneganScanNumber: 3154
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.0       1.7         640        R.CNITPCENMECR.D
  2.0       2.1      -16.37        K.EDRCSVCSCKDGK.I
  1.6       2.3      -13.40        K.EKESAPEMSSSCDK.R
Top scoring peptide matches to query 1425
Elution from: 41.54 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2022517.6 FinneganScanNumber: 3208
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1426
Elution from: 41.54 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 13390728.2 FinneganScanNumber: 3207
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1427
Elution from: 31.67 to 35.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 633140.5 FinneganScanNumber: 2104
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 48.9    0.0015        1.05    3   IPI00007752 R.AVLVDLEPGTMDSVR.S
 24.1      0.46        7.18                    K.VALVYGQMNEPPGAR.A
 17.0       2.4      -19.79                    -.MQGLLTSGRKPSGGGR.C
 16.7       2.5         610                    R.TMLTDPGAVPKGNATK.E
 12.0       7.5         633                    R.ETSHVTMVVAELER.T
  9.9        12       -8.36                    K.TFXLIKDYMSREK.H
  8.7        16      -17.67                    K.RPNEKNPGELAQHK.E
  7.9        19         627                    R.FMQVRSLQYLCR.F
  6.6        26      -15.32                    K.HMDGSFSVKPLKQK.Q
  5.7        32         614                    R.ADHQRGLVPPGADQR.G
Top scoring peptide matches to query 1428
Elution from: 31.43 to 35.43 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 633140.5 FinneganScanNumber: 2087
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 48.8    0.0016        1.05    3   IPI00007752 R.AVLVDLEPGTMDSVR.S
 17.5       2.1         610                    R.TMLTDPGAVPKGNATK.E
 16.4       2.7        7.18                    K.VALVYGQMNEPPGAR.A
 10.7        10         603                    R.LMRSSTDSLPGPISR.Q
  9.3        14         627                    R.FMQVRSLQYLCR.F
  6.4        27       -5.90                    R.SQVDPPTTTMQRLK.A
  5.4        34         617                    K.TFGTFSVEEYVLPK.F
  4.3        44         616                    R.VLKWMERSHGTEK.A
  3.9        48        16.2   28   IPI00022881 K.FNTLFAQGSYAEAAK.V
  3.3        55         605                    K.SHILDSSIYSNRPK.V
Top scoring peptide matches to query 1429
Elution from: 31.45 to 35.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 633140.5 FinneganScanNumber: 2088
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 66.2   2.8e-05        1.05    3   IPI00007752 R.AVLVDLEPGTMDSVR.S
 24.6      0.41        7.18                    K.VALVYGQMNEPPGAR.A
 19.9       1.2         637                    R.TNMTYEKMSRALR.H
 15.6       3.2      -19.79                    -.MQGLLTSGRKPSGGGR.C
 11.4       8.6         627                    R.FMQVRSLQYLCR.F
 11.1       9.2      -17.67                    K.RPNEKNPGELAQHK.E
 11.1       9.2         616                    R.VLKWMERSHGTEK.A
 11.0       9.4         628                    -.MVTVLDQMKAGTYK.L
  9.6        13         632                    R.HSISEWRMQSIAR.D
  7.6        20         603                    K.QLVRELISDVECR.S
Top scoring peptide matches to query 1430
Elution from: 38.27 to 42.22 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 514312.7 FinneganScanNumber: 2965
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.9       4.2       -2.32        R.AKVTLNGVPAQPLGPR.A
  3.6        18        13.3        K.EAPAGPPGAQKVARIR.H
  3.4        19        13.2        K.ASAELPVVLNVHGRR.V
  2.1        26         636        K.RKLVIPSELGYGER.G
  1.2        31         634        K.AVEILKTAREISMR.V
  0.4        37         621        K.AFRRPAHLSRHLR.G
  0.2        39        2.56        -.XSLLKLTQGETLRK.L
Top scoring peptide matches to query 1431
Elution from: 38.21 to 42.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 514312.7 FinneganScanNumber: 2958
Score greater than 17 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.2        12        4.63        R.LALLLSQFVGSQSVR.E
  4.5        15         638        R.HQKGLGGRAPSGAKPR.Q
  1.7        28       -0.34        M.SILFYVIFLAYLR.G
  1.1        32        8.66        R.SAKAGVIFPVGRMLR.Y
  0.9        34         636        R.NPIKIGYGKATPTTR.L
  0.6        36         623        K.TISVSSSKSGPVIAKR.E
  0.4        37         622        R.LPALGRALGHSIQQR.A
  0.3        38        9.10        K.LIFLFNEPSLIPSK.I
  0.2        39         636        K.YPAKNTTIALQAGLR.T
  0.2        39         634        K.ISKKSCLKPSDVVR.C
Top scoring peptide matches to query 1432
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 512732.0 FinneganScanNumber: 3087
Score greater than 20 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.6       6.5      -15.14        -.MWIMTRTWGGQAR.V
  7.1        11         625        -.MQPGGRSSGSSKGCGR.N
  6.5        13       -1.18        MAANSSGQGFQNKNR
  5.7        16         601        -.MESGLAGNGTGAGLVMK.V
  5.2        17      -16.68        R.STTQCKSPGSPHNPK.T
  5.2        18        14.6        R.RDTISQMTGGRMCP.-
  4.7        20         614        K.FSQTHHTSSATVQHG.-
  4.3        22         620        M.DEGMEISSEGNSLIK.A
  3.1        28         605        K.CQECKKTIMPGTR.K
  2.5        33      -10.59        R.HSDQGAWKPAVGCGR.L
Top scoring peptide matches to query 1433
Elution from: 41.69 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 416048.9 FinneganScanNumber: 3229
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1434
Elution from: 41.69 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 384940.1 FinneganScanNumber: 3230
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1435
Elution from: 33.23 to 37.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1096169.1 FinneganScanNumber: 2242
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 67.2   2.5e-05        1.36    2+  IPI00011654 R.AILVDLEPGTMDSVR.S
 19.1       1.6         598                    K.QLRLLEAMVEEQR.R
 18.5       1.9        5.10                    R.LNGALRQEQNFADR.F
 15.3         4         631                    R.VNMTYEKMSRALR.H
 11.9       8.6       -0.97                    R.LRENQLSESVSQNK.I
  9.3        16         598                    R.EREPKLSILQMDR.G
  6.0        33        12.0                    K.VETPHVTIEDAQHR.K
  6.0        34         624                    M.DARQPGERSQPHPR.R
  6.0        34         604                    R.KCSFIKLEAHQNR.V
  5.9        34        5.09                    R.NVTHIDQALQEAHR.V
Top scoring peptide matches to query 1436
Elution from: 33.09 to 37.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1096169.1 FinneganScanNumber: 2231
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 50.4    0.0012        1.36    2+  IPI00011654 R.AILVDLEPGTMDSVR.S
 18.4       1.9        12.0                    K.VETPHVTIEDAQHR.K
 12.9       6.8        16.8                    -.MPGQHGETLSTKTTK.I
 12.8       6.9        3.43                    K.DSPQPVEEKVGAFTK.I
 12.3       7.9         598                    K.QLRLLEAMVEEQR.R
  9.9        13       -0.97                    R.LRENQLSESVSQNK.I
  9.1        17         607                    R.VPAAAARGLSMDGSRR.V
  8.8        17         609                    K.MYWERKLQTFTK.E
  8.8        18         604                    R.KCSFIKLEAHQNR.V
  8.5        19         627                    K.VFYGNGDDIGVFLSK.S
Top scoring peptide matches to query 1437
Elution from: 33.09 to 37.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1096169.1 FinneganScanNumber: 2229
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 55.8   0.00035        1.36    2+  IPI00011654 R.AILVDLEPGTMDSVR.S
 22.3      0.78         598                    K.QLRLLEAMVEEQR.R
 20.2       1.3         631                    R.VNMTYEKMSRALR.H
 16.8       2.8        5.10                    R.LNGALRQEQNFADR.F
 15.4       3.8         624                    M.DARQPGERSQPHPR.R
 12.9       6.8        12.0                    K.VETPHVTIEDAQHR.K
 11.6       9.1         604                    R.KCSFIKLEAHQNR.V
 11.6       9.1        12.3                    K.KMVSYKEMLDTVR.Q
  9.9        14      -16.38                    R.SALKLKNEEVESER.E
  8.5        19        0.55                    M.SSGTMKFNGYLRVR.I
Top scoring peptide matches to query 1438
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 123194.0 FinneganScanNumber: 3088
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1439
Elution from: 35.82 to 39.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 554746.8 FinneganScanNumber: 2559
Score greater than 24 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.9         5       -5.25        K.MSKVISAASGGQDQER.K
 11.2       7.4         607        K.SEDAEVLDATPSGIMK.T
 10.6       8.4         591        R.ANPGGHRAPSSRGEGGR.E
 10.1       9.5        11.4        R.CNKAHPAPGPCAEVR.A
  9.0        12        18.2        R.SNSWAEIAPMKNCR.E
  8.3        14       -9.69        -.MAEGEGGAVMSLVEKR.E
  8.2        15       -8.09        R.RSGAMVKMAAAGGGGGGGR.Y
  6.6        21         585        K.VTADMVKEALEEAEK.A
  6.2        23        12.2        -.MADTQTQVAPTPTMR.M
  6.0        24      -16.04        -.XVSSPVGMIPDIYEK.E
Top scoring peptide matches to query 1440
Elution from: 35.79 to 39.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 554746.8 FinneganScanNumber: 2557
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.3       2.9         607        K.SEDAEVLDATPSGIMK.T
 11.3       7.1       -8.09        R.RSGAMVKMAAAGGGGGGGR.Y
 11.1       7.6       -8.09        R.RSGAMVKMAAAGGGGGGGR.Y
  8.9        12         607        R.SPSFPLEPDDEVFLA.-
  7.6        17       -9.69        -.MAEGEGGAVMSLVEKR.E
  5.7        26       -4.04        K.ASHGYGGRFGVERDR.M
  5.4        28         600        K.AEPSEVDMNSPKSKK.A
  4.9        31       -5.25        K.MSKVISAASGGQDQER.K
  4.3        36      -10.50        -.MAGAAMAERGHVPPPR.A
  4.3        36        1.52        R.NQELNSTESVMINGK.Y
Top scoring peptide matches to query 1441
Elution from: 30.71 to 34.69 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 775178.2 FinneganScanNumber: 2018
Score greater than 22 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.0       1.4       -4.79        K.KMKLEASQQNSEEM.-
  8.5       6.3      -11.55        K.KALSTQGSQTDMDMR.W
  0.6        39       -5.08        K.AGNRTAGSEPESSSYR.E
  0.4        41         607        K.AQNEVGSDTCVCTVK.L
Top scoring peptide matches to query 1442
Elution from: 30.63 to 34.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 775178.2 FinneganScanNumber: 2008
Score greater than 18 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.3       6.6        11.8        K.YDEMMELLRCHR.E
  5.7        12        11.8        K.YDEMMELLRCHR.E
  5.0        14      -11.55        K.KALSTQGSQTDMDMR.W
  4.7        15      -16.80        R.MACEVACGVLHLHR.N
  3.1        22         585        R.AWALGQGLECFETSV.-
  2.3        26       -4.79        K.KMKLEASQQNSEEM.-
  1.7        30         586        R.GSVTANMLCAGLESGGK.D
  1.5        32         607        K.AQNEVGSDTCVCTVK.L
  1.5        32         590        K.GMNSTESNSSASVRPK.V
Top scoring peptide matches to query 1443
Elution from: 30.63 to 34.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 775178.2 FinneganScanNumber: 2007
Score greater than 20 indicates homology
Score greater than 29 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2       6.8      -11.55        K.KALSTQGSQTDMDMR.W
  7.2       8.4        9.87        R.LEMHHSSSYGVDYK.R
Top scoring peptide matches to query 1444
Elution from: 34.43 to 38.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 468956.4 FinneganScanNumber: 2363
Score greater than 32 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 69.2   1.5e-05        1.11    1   IPI00301263 R.VLGTPVETIELTEDR.R
 14.8         4        6.51                    K.GIVHLNFLQVPMCK.E
 11.4       8.8       -1.69                    K.IMQRGASIPSQDPKK.R
  8.6        17       -5.61                    K.IIPELVGSPTQSTSSR.T
  8.4        18      -10.83                    R.SMGLPLQFGRITAHK.D
  7.7        21        11.8                    R.KSTSFMSVSPSKEIK.I
  5.0        39        13.0                    R.YPHLGQKPGGSDFLR.K
  4.9        40        10.9                    K.VLPSGIGHTTNCFLR.V
  4.5        44        15.4                    R.GRLLASSPAGEAGSWGR.A
  4.3        45        5.04                    R.AGDMLNLALKEQQPK.V
Top scoring peptide matches to query 1445
Elution from: 34.43 to 38.41 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 468956.4 FinneganScanNumber: 2361
Score greater than 31 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 68.0     2e-05        1.11    1   IPI00301263 R.VLGTPVETIELTEDR.R
 14.1       4.8        15.4                    R.GRLLASSPAGEAGSWGR.A
 11.9         8         596                    K.AVVSFEPSAAPTPKNR.I
 11.5       8.6         586                    R.QKLPMDLLVLEDEK.H
 11.3         9        6.51                    K.GIVHLNFLQVPMCK.E
  9.2        15       -5.58                    K.LVILEGELERSEER.A
  6.9        25         603                    K.YSGRDSLIFLVDASK.A
  6.0        31         601                    SKEIGLQMHEELLK
  5.7        33       -5.58                    R.ILQALLEKEDESQR.L
  5.4        35        15.7                    R.NMMVTGQLGLTEIHK.N
Top scoring peptide matches to query 1446
Elution from: 35.06 to 39.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1071552.9 FinneganScanNumber: 2439
Score greater than 21 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.1       7.9        8.83        R.FASLSXKMXSRLSSK.A
  9.6       8.8         579        R.MHPSLSHSEALASPAK.D
  8.0        13        0.50        R.WPWMVSTCLNTTIA.-
  7.5        14         579        K.AMTVEKASPVGDGNFR.N
  7.4        15         596        K.VTDFMLCVGHLEGGK.D
  7.0        16         594        R.HLEMDFEKSRSQR.E
  4.7        28      -13.55        K.DGDEEALKTMIKEGK.N
  4.1        31         599        R.EALSNDTTESLAANSR.G
  4.2        31         584        R.NLGLTPMDQGSLMAAK.E
  3.6        35         612        R.SAGGWSEAENGKEGTAK.E
Top scoring peptide matches to query 1447
Elution from: 35.04 to 39.03 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1071552.9 FinneganScanNumber: 2436
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.3         3         599        R.EALSNDTTESLAANSR.G
 11.4       5.8        0.50        R.WPWMVSTCLNTTIA.-
 11.3       5.9       -9.94        R.SPEASASASPHTPRER.H
 10.5       7.1         601        K.SEDAEVLDATPSGIMK.T
  9.7       8.6         580        -.MANRDSASPHSPPRR.R
  8.8        11         579        R.ADSKAASPALFMGPGSR.G
  7.2        15         587        R.SLERAANGSWREMR.G
  6.4        18         601        SNSELEDEILCLEK
  6.2        19      -16.38        R.VLVGRVSSCEQCTGK.G
  5.8        21       -9.67        -.MAEGEGGAVMSLVEKR.E
Top scoring peptide matches to query 1448
Elution from: 33.21 to 37.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 912541.3 FinneganScanNumber: 2240
Score greater than 32 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 93.3   5.4e-08        1.37    1   IPI00301263 R.LGGAVLSFSEATSSVQK.G
 13.3       5.5       -7.70                    K.IAEFSRTPEDFLKK.Y
  9.6        13        7.26                    K.DGKNPSWGPLSPAVQK.G
  7.9        19        16.4                    R.RIKELTYQTEEDR.K
  7.9        19         615                    M.CIIDMAVASALQFPK.K
  6.7        25         598                    R.NEFWAPLLEKAYAK.L
  6.0        29        11.9                    R.FTASSSSGMVPKLPAGK.M
  5.9        30         594                    K.KDKEIIAEYESQVK.E
  5.7        31        13.2                    K.HNLIQHAKDYWQK.Q
  5.6        32        15.8                    -.MMTQKVALLSYSHR.S
Top scoring peptide matches to query 1449
Elution from: 33.11 to 37.12 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 912541.3 FinneganScanNumber: 2233
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 69.9   1.2e-05        1.37    1   IPI00301263 R.LGGAVLSFSEATSSVQK.G
  8.5        16        2.85                    R.GFTTAAAVHVFTSMLK.Y
  8.3        17        13.2                    K.HNLIQHAKDYWQK.Q
  7.7        20      -16.78                    K.FYKELQQFSHILK.L
  7.4        21         611                    R.NRGMTALLKVSSCDK.N
  6.4        27      -16.40                    R.VGLQAQPMHSELVKK.I
  5.7        31        9.57                    R.LDYRISYMLSIYK.K
  5.0        37        8.06                    R.SLPVPQLVPETEDEK.K
  4.7        39       -9.69                    R.KQNMILSDEAIKYK.D
  4.4        42         609                    R.LPEQPGEGKPENEKK.G
Top scoring peptide matches to query 1450
Elution from: 33.13 to 37.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 912541.3 FinneganScanNumber: 2235
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 70.7     1e-05        1.37    1   IPI00301263 R.LGGAVLSFSEATSSVQK.G
  9.2        14       -7.70                    K.IAEFSRTPEDFLKK.Y
  8.6        16        9.57                    R.LDYRISYMLSIYK.K
  8.1        18       -7.69                    R.NQEFLLLPAEELHK.L
  7.7        20         583                    R.IKEGGAYIAKEEIMK.A
  6.0        29      -16.40                    R.VGLQAQPMHSELVKK.I
  6.0        29      -16.78                    K.FYKELQQFSHILK.L
  5.8        31        16.4                    R.RIKELTYQTEEDR.K
  5.7        32        7.26                    K.DGKNPSWGPLSPAVQK.G
  4.7        40       -9.69                    R.KQNMILSDEAIKYK.D
Top scoring peptide matches to query 1451
Elution from: 26.75 to 30.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 721630.0 FinneganScanNumber: 1687
Score greater than 17 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.5        11        5.07        R.APHPFGVPAPSAGAYSR.A
  3.5        52       -2.82        K.GETAVLQCIAGGSPPPK.L
  3.0        59         609        K.MLSSGVCTSTVQLPGK.V
  0.0   1.2e+02       -2.81        K.EMVALSDNIPAGVTHK.N
Top scoring peptide matches to query 1452
Elution from: 26.64 to 30.65 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 590190.0 FinneganScanNumber: 1677
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.1       4.2         603        R.APHPFGVPAPSAGAYSR.A
  9.9        11        15.6        -.MDPHKEVASTLWPR.G
  9.5        12        12.2        K.KENSETTLTRSASMK.L
  8.5        15         599        R.FNHPEQARLERER.G
  8.5        16      -16.55        R.WANGLSEEKPLSVPR.D
  7.0        22         595        R.DVYEEAIRTVMTVR.D
  6.8        23        8.95        R.ECYTHNGILHILGR.N
  6.7        23      -18.54        K.NLIEMSELEIKHAR.N
  6.2        26         582        K.QMLIIAADGQKHQGR.V
  6.1        27         592        R.GAAANRATYSPHPRGR.F
Top scoring peptide matches to query 1453
Elution from: 30.44 to 34.44 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 703691.9 FinneganScanNumber: 1993
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.3       9.4        8.29        K.EYITSSLVQQVSSSR.Q
  6.9        21        11.4        R.AQGPQANRPFCRGPK.Q
  5.7        27         604        K.ELMGFSKSVNEARSK.M
  5.5        29         594        R.QHMRWLWDIGGRK.S
  5.0        32         577        K.FHLNPQPQSRFRR.R
  4.9        33      -17.72        K.ESLGMLLQPDLQVPK.F
  4.2        39         615        R.QPLLSSSSLCCFRK.A
  4.0        40        12.2        K.ATDVRDAMAKTLYGR.L
  3.9        40         597        R.EAASQKLMVPGSTAHR.A
  3.9        41         580        R.NPRLEDAIRTDLNR.T
Top scoring peptide matches to query 1454
Elution from: 30.52 to 34.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 640340.7 FinneganScanNumber: 1998
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.3       4.7      -16.12        K.HDASALDIRMGTLKR.L
  9.0        13       -9.03        K.ELLAEYQDLTFLTK.Q
  8.9        13      -20.00        K.RVPEERLQDSVDLK.R
  6.1        25        14.2        R.QGSSLVVGGDGRYFNK.S
  4.7        34        16.0        R.IMGVVGRAPTHMGEGR.Q
  4.4        36        5.91        R.TLSELVLDFEAAYGR.C
  4.0        40         606        K.SHPVSVNGDTEWVKK.T
  4.0        40         604        K.ELMGFSKSVNEARSK.M
  3.9        40         589        R.DDLPLMANTSHILVK.H
  3.8        42         617        -.MDPHKEVASTLWPR.G
Top scoring peptide matches to query 1455
Elution from: 27.64 to 31.64 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1285961.4 FinneganScanNumber: 1768
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 30.2     0.093       -0.68    1   IPI00301263 K.DQMSHLFNVAHTLR.M
  7.5        18         587                    K.DFIIAVKSDDQNYR.V
  5.9        25        11.9                    K.LQFIHGYRGYDCR.N
  4.9        32         611                    R.ERTESAGAAPPPETDR.W
  4.8        33         600                    K.LLMNCSLNIDLSMK.L
  4.4        36        1.71                    -.MRSFTTSRSSGPGAAR.A
  4.0        39         591                    R.HQGNMLQIGYHLEK.Y
  3.1        48       -0.68                    K.MGGPSPPSPLGXRWSR.R
  2.9        51        10.7                    -.MDGLNFEMVAGLSLR.T
  2.7        53        7.58                    K.CFSQNTHLTRHQR.T
Top scoring peptide matches to query 1456
Elution from: 27.62 to 31.62 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1285961.4 FinneganScanNumber: 1764
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 41.4    0.0071       -0.68    1   IPI00301263 K.DQMSHLFNVAHTLR.M
 22.5      0.56        1.71                    -.MRSFTTSRSSGPGAAR.A
 10.0       9.9      -10.94                    R.MIMALVSDSALFNTR.E
  7.0        20      -10.94                    R.MIMALVSDSALFNTR.E
  5.9        25      -17.63                    K.MVMLQGVVPLDAHSR.F
  4.2        37      -10.95                    -.MASVGECPAPVPVKDK.K
  4.2        37       -6.94                    K.LWHLDPDVEYEIR.V
  4.0        39       -4.17                    -.MSKGTSSDTSLGRVSR.A
  3.8        41        0.12                    K.GVESPKSYSMQSQKI.-
  3.3        45       -0.67                    R.XMPSENPSPFIRTR.G
Top scoring peptide matches to query 1457
Elution from: 27.58 to 31.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1285961.4 FinneganScanNumber: 1758
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 34.8     0.033       -0.68    1   IPI00301263 K.DQMSHLFNVAHTLR.M
 22.1      0.61       -0.68                    K.MGGPSPPSPLGXRWSR.R
 10.2       9.5       -0.67                    R.XMPSENPSPFIRTR.G
  8.4        14       -7.34                    R.HVCRLYELHSSQR.Y
  5.7        27         607                    R.EENSHTEQPPLMKK.I
  5.3        29         595                    R.VLEEMEARFEKMR.S
  5.2        29      -13.62                    K.VFGSELATWPHPTSR.R
  4.2        37        19.5                    -.XAAAAAAAPSGGGGGGEEER.L
  4.0        39      -10.94                    R.MIMALVSDSALFNTR.E
  3.7        42         592                    K.ASTEVGEMAKQYIEK.S
Top scoring peptide matches to query 1458
Elution from: 27.58 to 31.58 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1285961.4 FinneganScanNumber: 1760
Score greater than 23 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 25.0      0.31       -0.68    1   IPI00301263 K.DQMSHLFNVAHTLR.M
  9.5        11        4.52                    R.TASNPKVENEDEPVR.L
  9.2        12         587                    K.DFIIAVKSDDQNYR.V
  6.3        23         607                    R.EENSHTEQPPLMKK.I
  5.0        31       -7.37                    R.SGPPGPPGGPGMPPGGRGR.G
  3.4        45        1.71                    K.DCGGGDALSNGIKKHR.T
  3.3        46         578                    -.MSRKASENVEYTLR.S
  2.9        50         592                    K.ASTEVGEMAKQYIEK.S
  2.4        56         587                    R.GETIFEIDPHLQER.V
  2.2        59      -13.22                    R.SSLTTHMAIHTGEKR.Y
Top scoring peptide matches to query 1459
Elution from: 27.58 to 31.56 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1095612.5 FinneganScanNumber: 1758
Score greater than 22 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 22.4      0.58         595    1   IPI00301263 K.DQMSHLFNVAHTLR.M
  8.3        15         615                    -.XAAAAAAAPSGGGGGGEEER.L
  7.3        18      -12.57                    K.TSQASEEVRTHAEIK.A
  5.9        26         604                    R.RGSQPCEEVDGVVPR.G
  5.5        28         611                    R.ASSGKSSSMPQXGFIR.E
  5.1        31      -12.58                    K.TGFSVSAEKSTSSNRK.N
  4.7        34         593                    K.IKGWYEKFGPGSCR.G
  4.5        35         582                    K.YFDTVPVAAAMCVLK.T
  4.0        39         607                    K.LQFIHGYRGYDCR.N
  3.0        50         613                    K.ANDSFGEASIIFSNGR.D
Top scoring peptide matches to query 1460
Elution from: 28.72 to 32.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6701397.4 FinneganScanNumber: 1845
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.9       8.4         614        -.MPPAQGYEFAAAKGPR.D
  8.2        20         599        -.MMPSRTNLATGIPSSK.V
  8.0        21         577        R.RLSTSPDVIQGHQPR.D
  6.8        27         603        K.YLEYREVPNSAPPR.Y
  6.8        28         599        R.KVLISDSLDPCCRK.I
  6.5        29         597        K.ETEPVEAYVIQKER.E
  6.1        32         610        K.EGVTALSVSELQAACR.A
  5.8        35         604        R.LGLILDSCSEQSGRR.Q
  5.7        35         588        -.MPSRGEGAPAVPPRPR.R
  5.7        35         612        R.RTTNVEEEFPELAR.R
Top scoring peptide matches to query 1461
Elution from: 28.91 to 32.89 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6701397.4 FinneganScanNumber: 1858
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 18.0       2.1         578        K.DQVKKNQLIQMAMK.C
 18.0       2.1         578        K.DQVKKNQLIQMAMK.C
  9.6        14        18.9        R.YGMNAAINTGPAPAVTK.T
  8.0        21       -2.59        GSKGDPVLAPGSFKGMK
  7.7        22         580        K.LMTENIRPNAFQIK.G
  5.8        35         607        M.PALREGNQHQRDNR.G
  4.0        52       -2.97        K.DRFGFSLYIALFDK.V
  3.8        55       -3.37        K.TMLAWGWRIERTR.E
  3.5        59         593        R.KRMQDLNLAMDALR.E
  1.8        86         595        R.GDGIAARGPGYGIMSIR.V
Top scoring peptide matches to query 1462
Elution from: 28.98 to 32.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6701397.4 FinneganScanNumber: 1868
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.0       8.3       -2.59        R.NLLFSGSPAVTMTPTR.L
  9.4        15       -2.59        GSKGDPVLAPGSFKGMK
  6.8        27         605        K.IRGIGHFCQEMAKK.G
  6.7        28      -17.44        R.LLMAELGLEIPAYSR.W
  4.5        46      -18.14        R.RGHEVRGILAEGGGQR.G
  3.4        61         593        R.GKGTLSSIIQNNSDTR.K
  2.4        75        6.44        R.RTMSEVGGSVEDLIAK.G
  1.8        87       -0.99        R.HELDHASIKGLCRR.S
  1.6        90         608        R.MGSNPARALQQMRSK.L
  1.5        92         604        R.VMADELTNSRAALQR.Q
Top scoring peptide matches to query 1463
Elution from: 28.74 to 32.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6701397.4 FinneganScanNumber: 1848
Score greater than 21 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.7        11         582        K.YYVDSVKGRFTISR.D
  7.8        22         597        K.YYADSVRGRFTISR.D
  7.5        24        2.08        K.LPAVNLSMLSGSDLMK.A
  6.0        33         591        R.LARLSATEPELGDYR.E
  5.1        40         578        K.DQVKKNQLIQMAMK.C
  5.1        40         578        K.DQVKKNQLIQMAMK.C
  4.6        45         607        M.PALREGNQHQRDNR.G
  3.8        55        19.1        K.NKTDTNSNQLSRASR.S
  3.4        60         601        -.MELLSPQSPFRVDR.G
  3.1        63         595        R.ARLMLSWDVSNGVAR.R
Top scoring peptide matches to query 1464
Elution from: 31.06 to 35.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1163848.0 FinneganScanNumber: 2047
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.4        24         597        R.HTRPQVSSVRLMER.S
  5.1        26         574        K.LLPADALVNCDLLLR.D
  4.5        30        18.9        R.VPKTSAQPVEGAVEER.E
  3.3        39        17.6        R.GRFGIPCCPVHLKR.L
  2.6        45         600        R.IKPAATSHVEGSGGVSAK.G
  2.4        48       -4.89        R.ENSLYLTAFTVIGIR.K
  2.3        50         586        K.LYKTGMNVPGSFILR.D
  2.1        52        5.58        R.AAFLLSTMAIAEVFGR.I
  1.3        62         577        R.DLPGQARGLRSALWR.V
  1.3        62        13.8        K.WLKHPGALEKQMSR.V
Top scoring peptide matches to query 1465
Elution from: 31.06 to 35.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1163848.0 FinneganScanNumber: 2048
Score greater than 23 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.4       1.5         600        R.IKPAATSHVEGSGGVSAK.G
  9.8       8.9         586        K.LYKTGMNVPGSFILR.D
  9.6       9.3        12.3        R.KKPLGERPKDEDER.T
  9.4       9.6         599        K.DMKLALRNVLFGMR.I
  8.4        12       -9.14        R.RLSVEESGLGLGLGPGR.S
  8.0        13      -11.91        K.LRPGERKMRPEVGR.E
  6.3        20      -13.89        K.VYIILFHPEQNVPK.R
  4.7        29        18.9        R.VPKTSAQPVEGAVEER.E
  3.4        38         600        R.TAGGSEPEREVVVPIR.L
  2.6        46        16.2        K.LSNHQLKMQIQNAR.S
Top scoring peptide matches to query 1466
Elution from: 31.06 to 35.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 657266.7 FinneganScanNumber: 2048
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.2       8.7      -15.59        R.IKVEPASEKDPESLR.Q
  9.5        13        3.05        K.RGARLTSTGLTFMDR.A
  9.2        14         586        R.VPKTSAQPVEGAVEER.E
  8.9        15         582        R.SRMLELSAPELEPPK.A
  5.6        32         583        K.LSNHQLKMQIQNAR.S
  5.3        34       -5.15        K.LEPCPEVDVGKLVSR.L
  4.4        42        3.06        R.TVCRAPSDQLLPANR.N
  3.8        48      -11.77        K.ALSSPGQPSKCVTIPR.S
  3.1        57       -0.78        R.SPSPKKPLSDKDGEGR.A
  2.8        61         596        R.HIKFGQKSHVECAR.F
Top scoring peptide matches to query 1467
Elution from: 31.06 to 35.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 657266.7 FinneganScanNumber: 2047
Score greater than 19 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3        21       -0.79        K.HTKELSPTSDTNLVR.S
  6.2        28         590        R.KASAHSIVECDPVRK.E
  4.5        41       -9.78        K.TPSWLQPSPTGKDRK.Q
  4.1        45       -7.40        R.KTEEGGDRGAPGLALAR.V
  3.9        47         573        R.AAFLLSTMAIAEVFGR.I
  3.8        48         585        R.LHSRQPGSASALGYPR.H
  3.4        53         579        R.KKPLGERPKDEDER.T
  3.1        57         611        K.IYDRQISKQGMSDR.V
  3.1        57         586        R.VPKTSAQPVEGAVEER.E
  2.7        63      -16.39        R.KTFSEKSSLIHHQR.T
Top scoring peptide matches to query 1468
Elution from: 31.18 to 35.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 657266.7 FinneganScanNumber: 2060
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.7         2        17.9        R.RPSPGEMRDQSPKGR.E
 13.4       5.3         590        K.AVPVPNMTPSAVGRER.H
 11.3       8.5      -16.39        R.KTFSEKSSLIHHQR.T
 11.2       8.9         607        R.SEMMKKPSQAPKYR.T
 11.2       8.9         607        R.SEMMKKPSQAPKYR.T
  8.6        16         611        R.HEKVQENCIDLVGR.I
  7.6        20         594        R.GFTTAAAVHVFTSMLK.Y
  6.9        24         599        K.EYTSAVTELVKDDVK.N
  6.0        29       -9.76        K.DKAYVQARVLESYR.S
  5.3        34         581        K.WLKHPGALEKQMSR.V
Top scoring peptide matches to query 1469
Elution from: 31.06 to 35.06 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9739756.7 FinneganScanNumber: 2046
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.8       6.1      -13.86        R.KTFSEKSSLIHHQR.T
 12.3       6.8       -8.13        K.RYMKVLWPQYWK.M
  9.7        12       -1.40        R.SYSRLKPGYRWER.Q
  8.6        16         612        R.RHQGKQNELSDTAGR.E
  8.4        17       -9.22        K.TLKMGNLSEVEHLAR.E
  8.0        18         607        K.MFSLSSMKFYRGVK.K
  6.2        27         607        R.HRALETIQNAVECR.A
  4.5        41         610        R.SEMMKKPSQAPKYR.T
  4.5        41         610        R.SEMMKKPSQAPKYR.T
  3.9        47         575        R.GGSSATSGTPRAGLKPPR.L
Top scoring peptide matches to query 1470
Elution from: 31.04 to 35.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9739756.7 FinneganScanNumber: 2044
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.7       4.9        1.75        R.SPSPKKPLSDKDGEGR.A
 11.2       8.8         595        K.TEFTLTEAVVESSRK.L
 11.1       8.9         607        R.SVRCIQPLHDNTTR.S
 10.6        10       -9.22        K.TLKMGNLSEVEHLAR.E
  8.4        16         610        R.SEMMKKPSQAPKYR.T
  8.4        16         610        R.SEMMKKPSQAPKYR.T
  7.2        22      -13.86        R.KTFSEKSSLIHHQR.T
  6.8        24       -8.13        K.RYMKVLWPQYWK.M
  5.0        37        18.8        R.TQMTLTFQKEVAER.L
  4.2        44       -3.51        R.GPMFFLIAXLLAWR.K
Top scoring peptide matches to query 1471
Elution from: 30.99 to 34.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9739756.7 FinneganScanNumber: 2040
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8        12         607        R.SVRCIQPLHDNTTR.S
  8.5        16         599        K.CAKLPTTAFTRSSEK.S
  8.2        18         586        R.NDPLLVGVPASENPFK.D
  6.9        24       -9.22        K.TLKMGNLSEVEHLAR.E
  6.8        24         607        R.HRALETIQNAVECR.A
  4.9        37        7.59        K.TPPRWAEDQNSLRK.M
  4.8        38         603        MEVLPCSRVAHIER
  4.8        38         578        K.VPANPEALLLMASSQR.D
  4.8        38       -8.13        K.RYMKVLWPQYWK.M
  4.3        43         610        R.SEMMKKPSQAPKYR.T
Top scoring peptide matches to query 1472
Elution from: 30.99 to 35.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 9739756.7 FinneganScanNumber: 2041
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.0       2.3         575        R.GGSSATSGTPRAGLKPPR.L
 10.1        11        1.76        K.LDSAAHLSLTEEKQR.L
  8.3        17        1.75        R.SPSPKKPLSDKDGEGR.A
  7.4        21         606        R.DVMQETFKNLTSVGK.T
  7.2        22         612        R.RHQGKQNELSDTAGR.E
  7.0        23         603        K.EHNLKVASEEKQER.L
  6.3        27        18.0        R.GWGRHTVGELLMADR.K
  5.6        31         602        K.EYTSAVTELVKDDVK.N
  5.3        34       -8.13        K.RYMKVLWPQYWK.M
  4.9        37         610        R.SEMMKKPSQAPKYR.T
Top scoring peptide matches to query 1473
Elution from: 31.18 to 35.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 2061
Score greater than 18 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.2        31        19.1        R.VGQHWLSSTSKCRR.C
  5.6        36         573        R.QLRNPPTTIGMMTLK.A
  5.0        41       -6.09        K.GKVPLQFSGQNEKNR.V
  1.8        85         600        R.ITKYMSRVHGMHPK.E
  1.8        86        13.2        K.LGCIYPSSLMKAFAK.S
  1.7        89         573        R.LEQLHGELRELHAR.I
  1.6        90         579        R.GRFGQGTGPILLDDVR.C
  1.0     1e+02       -1.44        K.QVLREKEAALEEMR.K
  0.9   1.1e+02        12.5        R.HMRTQRQGGYLQAR.E
  0.6   1.1e+02      -10.44        K.LVNPAKKSGCGWASVK.Y
Top scoring peptide matches to query 1474
Elution from: 24.53 to 28.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 474898.6 FinneganScanNumber: 1466
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.9       4.7         608        K.RENHILASGSVRIPR.F
Top scoring peptide matches to query 1475
Elution from: 24.53 to 28.52 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 474898.6 FinneganScanNumber: 1465
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1476
Elution from: 40.18 to 44.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 84896.5 FinneganScanNumber: 3089
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.1        17       -0.52        M.SENAAPGLISELLLQR.G
  6.4        20        11.8        K.AGRLGSTVFVANLDYK.V
  6.3        20      -16.01        R.RASSEQALWLLLPAR.C
  6.0        21         592        K.IGDLGLATLMRTSFAK.S
  5.9        22        20.0        R.KVGNNSSHFLQPNLR.G
  4.5        30         607        R.SDQMLKQVAVPQPPR.L
  4.0        34       -1.31        R.KKLNSSHLSLFHGSR.E
  3.9        35         582        R.GPPATDGLGAKVKLEEK.Q
  3.9        35         594        K.AGQSPQLLIYTLSYR.A
  2.6        47       -9.46        K.KVGDWILATSAIPPSR.L
Top scoring peptide matches to query 1477
Elution from: 40.18 to 44.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 160401.1 FinneganScanNumber: 3089
Score greater than 18 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.3        20        16.0        R.SMVSTSGAATASSAAGPSR.G
  5.5        24       -5.72        R.LMNRSISCTMKNPK.V
  5.1        27      -14.13        K.TGELKNIGECGRSYK.F
  3.9        35        13.2        K.AHLMMITCFDITSR.R
  2.9        44        13.7        R.DLAASDDYRGCLDLK.L
  2.8        46         586        K.FYNMMTKTQMFIR.F
  2.5        48      -14.93        R.WAGPGSSGLCLSHARR.S
  1.4        62         568        K.FVKINNSTNEGMNVK.K
  1.3        64         593        R.LCGDLVSCFQERAR.I
  1.2        66       -0.99        K.EELMLRLQDYEEK.T
Top scoring peptide matches to query 1478
Elution from: 31.22 to 35.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 590984.9 FinneganScanNumber: 2066
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 26.8      0.25        19.7        R.IEAASMSGAGRRTVHR.E
 12.1       7.3         567        K.KIRLQIWDTAGQER.F
 12.1       7.3         567        RIKLQIWDTAGQER
 12.1       7.3         567        K.RIKLQLWDTAGQER.F
  8.3        17        13.8        -.MMSIKAFTLVSAVER.E
  8.0        19       -7.47        K.VCAPVLAKPGVISVMGT.-
  6.1        30         587        K.GEVVRVHNNHFHIR.C
  5.8        31        19.3        R.AWFVSLDGRSNAHVR.H
  5.8        32         588        K.KRLIEDTEDWRPR.T
  5.8        32         576        R.LNRVEDKVTQLDQR.L
Top scoring peptide matches to query 1479
Elution from: 31.15 to 35.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 597880.6 FinneganScanNumber: 2056
Score greater than 16 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.8        25        11.5        R.NIGAGVMQIDIIQGNR.L
  2.9        61        5.00        R.MLQQQEQLRALQGR.Q
  1.3        89        6.97        R.ASSNQRGLNQIWNVK.K
  0.3   1.1e+02       -5.36        R.ARPSTKTPESSAAQRK.R
  0.0   1.2e+02         594        K.LFITEFPKPEFMSK.S
Top scoring peptide matches to query 1480
Elution from: 27.47 to 31.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 487136.3 FinneganScanNumber: 1748
Score greater than 23 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.4       3.7       -4.71        K.INDAIADQMALFIQR.M
 15.0         4       -0.40        R.NLDIERPTYTNLNR.L
  9.8        13       -4.72        K.NLDTVRAVWTMGDIK.T
  9.2        15        18.4        R.DLLNHAFFAEDTGLR.V
  8.7        17         569        K.VTEEPMGITLKLNEK.Q
  8.0        20         596        K.IINNNLGIDEASWMK.R
  6.0        32       -0.42        K.RVSLEPHQGPGTPESK.K
  4.5        45         603        R.DLDNMAFPQALPLEK.R
  3.7        54         584        K.LIQRSSPEADLTMEK.I
  3.7        54      -17.41        K.LLVLDVDYTLFDHR.S
Top scoring peptide matches to query 1481
Elution from: 27.47 to 31.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 487136.3 FinneganScanNumber: 1749
Score greater than 24 indicates homology
Score greater than 34 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 12.6         7         603        R.DLDNMAFPQALPLEK.R
 12.4       7.3         569        K.VTEEPMGITLKLNEK.Q
 11.1        10         575        K.LNLNLTCPNPSAPPPL.-
  8.3        19         596        K.IINNNLGIDEASWMK.R
  8.3        19       -4.71        K.INDAIADQMALFIQR.M
  7.2        24        3.65        M.VTAAMLLQCCPVLAR.G
  5.7        34         604        M.YSAHRPLMPASSAASR.G
  5.7        34       -4.71        K.VKNGYVNPELAMQGAK.N
  4.6        44        1.84        R.ILLDNDHYAMEKLK.K
  3.9        53         601        K.DDDNLDSLLDSVVGLK.Q
Top scoring peptide matches to query 1482
Elution from: 31.18 to 35.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 463051.5 FinneganScanNumber: 2059
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.9       4.8      -16.42        K.ELTGDMQLSKSEILR.T
 12.0       7.5      -10.67        K.VMGFLADKKPEQGQR.V
  9.4        14        8.55        R.RMTVIIPGMSAENER.V
  7.5        21       -1.79        K.NLDQMKKQISDVER.D
  6.2        28         564        K.KPLSKXEMQSAGSQR.G
  4.6        41       -1.80        K.LRASVSTKCNLEDQV.-
  4.5        42      -18.66        R.RSTQESLTAGGTDLKR.E
  4.2        45         582        K.ETLSKGETPETSRQR.K
  3.3        55         583        R.FVMGPTVAAPQERSGR.E
  2.2        71       -8.69        K.EYTNPEQIKQWRK.N
Top scoring peptide matches to query 1483
Elution from: 31.17 to 35.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 463051.5 FinneganScanNumber: 2058
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2        18         578        R.MNALADALKSINNAEK.R
  6.9        24        14.3        K.REEVHKYVQMMGGR.V
  5.4        34         569        -.MPPRELSEAEPPPLR.A
  4.3        44        9.73        R.HPQGEQMYRRVYR.L
  4.1        46         571        K.TKQRLQGEVEDLMR.D
  3.9        49         591        R.LMVPEDISELETAQK.L
  3.8        49         592        R.KPTGAPSCTNTTXSAGR.C
  3.8        49         592        R.KPTGAPSCTNTTXSAGR.C
  3.8        50        10.5        K.SLLCLLYSNSQEHR.N
  3.7        51         583        R.YLRCPAAMTVMHLR.K
Top scoring peptide matches to query 1484
Elution from: 29.15 to 33.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 773614.1 FinneganScanNumber: 1886
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 17.8         2         589        R.VMVVGPTDVGKSTVCR.L
 11.6       8.5       -0.62        R.VFIIKSYSEDDIHR.S
  7.6        21         593        K.KHPDSSVNFAEFSKK.C
  7.3        23         591        K.LSAANQKEPMNLNFK.V
  5.6        34         592        R.AAAHIHSSPGRSTCLR.Q
  4.4        44         593        R.NPWTGVSQFLQTSQK.I
  4.4        45         580        K.GPPGPPGKDGLPGHPGQR.G
  4.2        47         595        R.QSEVPKPEDGEPPRR.H
  3.9        50        12.0        K.MSQRQGKEAYPTPTK.D
  3.8        51         570        K.TMSLILHAADISHPAK.S
Top scoring peptide matches to query 1485
Elution from: 29.10 to 33.11 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 754369.8 FinneganScanNumber: 1881
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.8        13         567        R.SNLTTHQVIHTGEKR.Y
  4.9        40        16.3        K.NSPNNISGISNPPGTPR.D
  4.7        42      -19.94        MCVAQVLTAHLLPPR
  3.9        50       -0.63        R.VLPWKQGLEDTHLDA.-
  3.8        51      -17.96        K.SMFFHAKPSREIKK.S
  3.7        52       -0.63        K.DRSGIETFSPPPPPPK.S
  3.3        57         584        K.HVSDDMKTHKNPALK.A
  3.0        62         585        K.IDLNTGKETGTPISMK.D
  2.6        68      -19.43        R.VPEVNDLRALVEDPR.L
  2.5        69        5.51        R.CNLGQRPLEAVPDPR.Q
Top scoring peptide matches to query 1486
Elution from: 24.56 to 28.54 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 282753.9 FinneganScanNumber: 1469
Score greater than 23 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.8       5.6         575        R.KVTVDLQPVWPPVSR.Y
  9.6       7.2        19.8        R.VDGLLHQLTLQSNQR.I
  8.6       9.2      -12.12        R.LGSAPEVLLVRKHMR.E
  7.5        12         571        K.VTKNAVQALIDKHQR.I
  7.2        13         595        K.FFRNKYQLIAHQR.V
  7.1        13        13.3        K.LQAITASSANLRHSPR.V
  6.6        14        5.26        K.IKALNHEIEELEKR.K
  5.9        17        4.46        R.RRAWSPLASPQPSLR.S
  5.8        18         590        K.NVKEVSFYRGAVPVR.V
  5.4        19       -5.58        R.KLSQLEAMIRFLTR.K
Top scoring peptide matches to query 1487
Elution from: 31.33 to 35.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 734011.0 FinneganScanNumber: 2073
Score greater than 24 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.9       7.4         568        K.RYPPAYGPDGKPRPR.F
 11.1       8.8       -2.20        K.MIYLQWKMSVEKR.Q
  9.1        14        17.0        K.WTAPESLAYNTFSIK.S
  9.0        14        16.6        R.MNNVTTLHLWQSAGR.G
  8.5        16       -2.22        K.VNVVLQNFMYTMLR.D
  8.1        18         596        R.TEELAQAYDAFTLVR.A
  6.9        23        6.24        R.YFRPYSLMVVPPDK.V
  6.0        29         566        R.FLPDQFSKKASPAYK.M
  5.8        29        18.9        R.SIIGMIDMFHKYTR.R
  5.8        30        4.38        K.GAGTDDHTLIRVMVSR.S
Top scoring peptide matches to query 1488
Elution from: 31.33 to 35.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 734011.0 FinneganScanNumber: 2076
Score greater than 23 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.2        11         577        R.YSGRTQRQLLEYGR.K
  9.4        13         577        -.MRDMAIKVKPNYTK.S
  9.0        14         596        R.TEELAQAYDAFTLVR.A
  8.1        18         598        R.QSIERGAFEGARYSR.S
  6.6        25        0.12        K.KHMEVCQKLQDALK.C
  5.1        35        10.4        R.KMSVIVPGMNMVHER.V
  3.9        47       -2.12        R.IPTVDGRPRGTSGMGAR.V
  3.6        49         583        R.FFSNRIIVSDQSSAR.S
  3.5        50        15.2        R.ERSPGPVDTRSPASSGK.A
  3.4        52      -16.69        K.VLGITVSGGRGLACDPR.S
Top scoring peptide matches to query 1489
Elution from: 24.51 to 28.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2620788.8 FinneganScanNumber: 1459
Score greater than 19 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4        11         580        K.SPRLVAPVPPGAAPANGR.L
  7.3        11         583        R.ALVDVTGRLNQTRAGR.D
  7.2        11         568        K.DLIRVGRALSAGNGVTK.V
  6.0        15         585        R.LVEFTSSGSVLLFVTK.K
  5.2        18      -10.91        R.LIPKYRVINPGTNSR.K
  4.5        22        16.7        R.TRIHSLPSYGLENLK.K
  3.9        25         596        R.QKQLLNENNNTGIIK.G
  3.5        27         566        K.LSSRYAAASLPPLPRK.V
  2.9        31         591        K.RAAAPVVSVPCIPPHR.L
  2.9        31         601        K.TFVQHYAFIMKTLK.K
Top scoring peptide matches to query 1490
Elution from: 24.51 to 28.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 939026.7 FinneganScanNumber: 1460
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.5       8.2         584        -.XSFSSQKVRLVIAEK.G
  8.2       8.8        7.58        R.AIRPTVAIPHEPVSSR.T
  4.6        20        19.8        R.RPTLPYRTWEAALR.Q
  4.1        22        1.11        K.AAREYRVNAQGLLIR.T
  4.0        23         575        K.GLTLLHPFFRLSTAR.L
  4.0        23         590        R.QFLILKNQTPIEER.G
  4.0        23       -8.90        VQMKTIQLKLENIR
  3.1        28         596        K.LVVFSWEPTPRKNR.V
  2.8        30         568        R.RIFILGPSHHVPLSR.C
  2.4        33         594        K.GMQLLVFPRPGQTLR.F
Top scoring peptide matches to query 1491
Elution from: 29.04 to 33.04 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 401012.5 FinneganScanNumber: 1875
Score greater than 21 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.0        15        17.4        NQINFWRNQMTKR
  8.3        18         599        K.LQQPEAAAGVLEYAMK.H
  6.2        28         596        K.DGSGDYQSRGLVKAPGK.S
  4.6        41         572        R.THWKRAFNATSFLR.H
  4.4        43      -18.08        K.VIHPSLKQFLNMHR.I
  4.2        45         592        R.EEKLWMKELQTQR.G
  3.7        50         586        K.NMQTTQIKQLFNPR.T
  3.1        58       -7.06        R.ALNFTKHLLMMEKK.L
  2.8        63        3.26        K.TPVPSDVFFVNSLWK.G
  2.0        75      -13.06        R.SPGSTHQGSLASGVLPIK.C
Top scoring peptide matches to query 1492
Elution from: 24.48 to 28.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 143975.6 FinneganScanNumber: 1457
Score greater than 14 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.8        53        5.00        VASGPMPVHTTSKRPR
  1.3        75        7.70        R.GTGGPPTVQLLSALAGSPGG.-
Top scoring peptide matches to query 1493
Elution from: 24.45 to 28.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 143975.6 FinneganScanNumber: 1455
Score greater than 15 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.4        46         564        R.ALKMHGGGPSVTAGVPLK.K
  2.5        57        13.5        M.ENLESRLKNAPYFR.C
  1.8        66       -7.52        R.QALGPEAPAPAKPGPHAK.E
  0.8        84         581        K.VCFEMKVTEKIPVR.H
  0.6        87         579        K.TLPAQACTRSFSLRK.T
  0.5        90         560        R.KPSKIVSTYLQESQK.K
  0.3        93        1.27        R.EEVSRLQEEVHLLR.Q
  0.0     1e+02         560        R.QLEALLSSLPPPQSQK.E
Top scoring peptide matches to query 1494
Elution from: 24.48 to 28.47 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 382668.0 FinneganScanNumber: 1457
Score greater than 14 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.9        48         581        VASGPMPVHTTSKRPR
  1.3        69         584        R.GTGGPPTVQLLSALAGSPGG.-
Top scoring peptide matches to query 1495
Elution from: 24.45 to 28.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 382668.0 FinneganScanNumber: 1455
Score greater than 14 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.5        52         590        M.ENLESRLKNAPYFR.C
  1.8        61         569        R.QALGPEAPAPAKPGPHAK.E
  0.3        86         578        R.EEVSRLQEEVHLLR.Q
  0.2        88        0.03        K.VSVVNPTAQCTHALLK.M
Top scoring peptide matches to query 1496
Elution from: 32.79 to 36.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1468513.5 FinneganScanNumber: 2202
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.4         4         566        R.TAASGARSRPEPGTQVR.S
 13.9       4.5         558        M.ALSIPSDSTLPAEARGR.E
 13.8       4.6       -8.07        R.NKMGDDLILMHVSLR.L
 13.5       4.9        4.57        K.AEVLLQAGHYDADAIR.E
 12.4       6.3       -3.83        R.VRDVINSMEHAIVSR.S
 11.6       7.8         575        K.TGIINCPDGISIPDLR.D
 11.4       7.9       -8.34        K.AGRSLEPRSSRPAWAT.-
 11.0       8.8       -9.90        R.HLPKSDVSGLSDPYVK.V
 10.8       9.2        0.42        K.DLQSTSADHKLQSRR.S
 10.1        11         589        R.EMEREITRSLFSSR.V
Top scoring peptide matches to query 1497
Elution from: 28.49 to 32.50 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2150457.8 FinneganScanNumber: 1829
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 23.0      0.56        19.7        K.VFPSLDEEVPPAEANK.E
 13.4       5.1       -5.82        R.NKMGDDLILMHVSLR.L
 11.0       8.9        12.8        R.LCGNALLPSLFFSMR.G
  9.6        12        17.0        K.GKCTTDHISAAGPWLK.F
  8.8        15         568        R.TAASGARSRPEPGTQVR.S
  8.1        17       -7.62        R.NDLNNWVAEEILAIK.Y
  6.7        24        1.79        K.ATWRLPAACWTGVPR.W
  6.7        24         589        K.GLPEEYSVAAMFRVR.R
  6.7        24        4.88        K.CQAGSLPAILPASEATR.W
  6.0        28         560        M.ALSIPSDSTLPAEARGR.E
Top scoring peptide matches to query 1498
Elution from: 41.66 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 702275.5 FinneganScanNumber: 3225
Score greater than 18 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5        33         560        K.ASFFLSHDQRFFLK.T
  5.1        36         582        K.TGQMYPVPANHLDKR.E
  4.2        44         572        K.ISDFGTSKELSDKSTK.M
  3.4        53        8.07        R.ERGSDASGQLFHGRAR.E
  3.3        54       -4.14        R.SGWAQPEPMELAKRK.D
  3.2        56         556        R.YPFAPMYGGFPVKLR.T
  3.0        59         587        R.EHALEKEITNSDQTK.A
  3.0        59         567        K.FLQPGSPRKPPMDEK.S
  2.8        62       -8.27        K.QLEMNLAEAERQRR.L
  2.3        68      -16.29        -.XVDLQNVLVVCESAAR.L
Top scoring peptide matches to query 1499
Elution from: 41.66 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 83745.1 FinneganScanNumber: 3226
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 20.2       1.1         568        R.AQSQSGVDLQEDVLVR.E
 11.8         8         561        K.RSQEDEISSPVNKVR.R
 10.0        12       -1.78        K.RKMEHDGSLFQAVGIG.-
  9.6        13       -9.64        K.GKSRAAENASLGPTNGSK.L
  9.5        13       -3.18        R.RDELSEEINNLREK.V
  7.5        21         563        K.IRMNVDQAFHELVR.V
  7.0        24         571        K.DNVEGGIWSKIFNHK.T
  6.6        26         577        R.VGGTASWLPGCAQRQR.G
  6.5        27         572        -.MKSSVAQIKPSSGHDR.R
  6.3        28       -7.45        -.MVGGEAAAAVEELVSGVR.Q
Top scoring peptide matches to query 1500
Elution from: 34.24 to 38.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2522706.4 FinneganScanNumber: 2336
Score greater than 27 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 31.6     0.042         575   29   IPI00168218 R.DSGGQTSAGCPSGWLGTR.R
 12.6       3.4         541                    -.MEDHQHVPIDIQTSK.L
 11.6       4.2         542                    R.MDAMLLRQCPTQGTR.K
 11.6       4.3        4.50                    R.TGTTGQSGAESGTTEPSAR.V
 10.0       6.2       -8.11                    R.DWLNTGSKDLSAECAK.I
  8.4       8.8         542                    R.MDAMLLRQCPTQGTR.K
  8.3       9.1         544                    K.KGCTWGPNSIQMKDR.T
  7.5        11         565                    R.EQEEDQMLRDMIEK.L
  6.7        13      -18.50                    R.EFIQGTNPMNVMNVGK.L
  6.6        13       -9.97                    K.SNNMNLDQAMSALLEK.K
Top scoring peptide matches to query 1501
Elution from: 34.30 to 38.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2522706.4 FinneganScanNumber: 2347
Score greater than 25 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 18.9      0.78         575   29   IPI00168218 R.DSGGQTSAGCPSGWLGTR.R
 18.1      0.96        4.50                    R.TGTTGQSGAESGTTEPSAR.V
 10.8         5        13.9                    R.QQGGGMMMGPGGGGAASLSK.A
  9.8       6.5        6.67                    K.ETSMTEPSEPGSKAEAK.K
  9.2       7.3        11.7                    R.SRFTSEETLMFCMR.V
  7.6        11      -16.25                    R.TSRMSQSGCPSGLLADK.N
  7.3        11         541                    R.QPFTEESPSSRCIQK.D
  7.0        12         542                    R.LEEEEEMNSELVAKK.R
  6.2        15       -8.12                    -.MADQAPFDTDVNTLTR.F
  5.9        16      -12.98                    K.ICHYPFTVKANCER.H
Top scoring peptide matches to query 1502
Elution from: 34.18 to 38.17 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2522706.4 FinneganScanNumber: 2330
Score greater than 26 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 21.6      0.42         575   29   IPI00168218 R.DSGGQTSAGCPSGWLGTR.R
 11.7       4.1       -5.85                    R.ECNEGSTERQKSIEK.K
  8.3         9        13.9                    R.QQGGGMMMGPGGGGAASLSK.A
  7.9        10         544                    K.KGCTWGPNSIQMKDR.T
  5.5        17        9.55                    R.VENSYGQERRCHLM.-
  4.8        20      -10.23                    R.RDSPYAEINNSTSANR.N
  4.4        22        3.28                    K.CKNCEAFGHTARSTR.C
  4.4        22      -18.50                    -.MDGAVMEGPLFLQSQR.F
  4.4        22        4.54                    K.TAESESLDSKENNNTR.I
  4.0        24      -18.49                    K.FELSGCTSMKTYRAK.F
Top scoring peptide matches to query 1503
Elution from: 34.18 to 38.17 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2522706.4 FinneganScanNumber: 2329
Score greater than 24 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 22.2      0.37         575   29   IPI00168218 R.DSGGQTSAGCPSGWLGTR.R
 10.3       5.7        4.50                    R.TGTTGQSGAESGTTEPSAR.V
  9.7       6.5        6.67                    K.ETSMTEPSEPGSKAEAK.K
  9.5       6.8        13.9                    R.QQGGGMMMGPGGGGAASLSK.A
  8.7       8.3      -16.25                    R.TSRMSQSGCPSGLLADK.N
  8.1       9.4         565                    R.EQEEDQMLRDMIEK.L
  6.4        14         542                    R.LEEEEEMNSELVAKK.R
  5.9        16         544                    K.KGCTWGPNSIQMKDR.T
  5.0        19        13.9                    R.QQGGGMMMGPGGGGAASLSK.A
  2.8        32        13.9                    R.QQGGGMMMGPGGGGAASLSK.A
Top scoring peptide matches to query 1504
Elution from: 23.71 to 27.70 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 606172.6 FinneganScanNumber: 1375
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1505
Elution from: 23.73 to 27.72 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 606172.6 FinneganScanNumber: 1376
Score greater than 14 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.5        10         567        K.VEPDNSSQATGEGCGHR.L
  1.2        17        0.18        K.MQEEEGEGHGSGVGVGSR.L
  1.1        18         539        R.EPCENYMKCVSVLR.F
  0.8        19       -6.27        R.CMGAMQEGMQMVKLR.G
Top scoring peptide matches to query 1506
Elution from: 26.23 to 30.23 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1017885.8 FinneganScanNumber: 1633
Score greater than 18 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.8       2.5      -13.64        R.QSTEGSLEMETAFNSR.G
  5.6       4.2      -10.40        R.LWEQFSDMGFQQDR.I
  4.7       5.1       -5.93        -.MANDSGGPGGPSPSERDR.Q
  4.7       5.2      -10.03        R.SSDMSLPDSMGAFNRR.K
Top scoring peptide matches to query 1507
Elution from: 26.27 to 30.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1017885.8 FinneganScanNumber: 1636
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5       4.3      -18.01        K.GAGESGEEDPFPSRDPR.S
  3.8       6.3       -5.93        -.MANDSGGPGGPSPSERDR.Q
  2.0       9.5         547        K.MQEEEGEGHGSGVGVGSR.L
  0.8        13      -10.40        R.LWEQFSDMGFQQDR.I
  0.4        14         553        K.QACANCEYELQMLR.H
Top scoring peptide matches to query 1508
Elution from: 26.29 to 30.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1017885.8 FinneganScanNumber: 1639
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.3       4.5      -10.40        R.LWEQFSDMGFQQDR.I
  0.6        13      -14.41        K.ATSGGCQPPGDSATGFHR.E
  0.1        15        0.31        K.QTAGQGSPCEEQEEPR.A
Top scoring peptide matches to query 1509
Elution from: 33.29 to 37.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 631707.6 FinneganScanNumber: 2249
Score greater than 22 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.6       7.4       -1.21        R.RGMSVWLPSPAGAWRR.T
  9.1        13         531        R.EEKLSLRAAGTAAPAQGR.K
  8.5        15        15.2        R.AYSQSPRHALYPPSPR.K
  4.8        36         553        R.DLKPENIMLSSQGHIK.L
  1.2        80       -7.98        K.EVLRAENDAQKPSLTR.A
  0.1     1e+02        14.0        K.MIDGESGEKTFRTLVK.S
  0.0   1.1e+02         551        R.SAVSGTATQPRAAAVHSSK.K
Top scoring peptide matches to query 1510
Elution from: 33.31 to 37.30 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 631707.6 FinneganScanNumber: 2251
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.0       8.4         553        R.DLKPENIMLSSQGHIK.L
  6.8        22        13.3        R.VAVPNGQPPSAARYMPR.E
  1.4        76         531        R.EEKLSLRAAGTAAPAQGR.K
  1.4        76         549        K.RLQLQCQPAGGTGQRR.G
  1.2        81       -1.21        R.RGMSVWLPSPAGAWRR.T
  0.7        91       -7.98        K.EVLRAENDAQKPSLTR.A
  0.6        93         567        R.VFVPLPGSTVMLCDYK.F
Top scoring peptide matches to query 1511
Elution from: 31.77 to 35.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2548097.6 FinneganScanNumber: 2118
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
  8.8        13       -0.49    1   IPI00301263 R.VLGTPVETIELTEDRR.A
  5.5        27        13.2                    K.VIPAVSISYVVYENMK.Q
  5.3        28         552                    R.KEPEIMKNIIGFYTK.G
  5.2        29         554                    -.MELWAPQRLPQTRGK.A
  3.5        44         542                    -.MGMYPPLLLKIYLSR.H
  2.6        54         554                    K.HGSALDVLLSMGFPRAR.A
  2.4        55        7.01                    R.VIVTDTWVMKVTTYR.V
  2.0        61       -8.84                    R.GHYTIGKEIVDLVLDR.I
  1.6        66        0.87                    K.LVISVHGGIQNFTMPSK.F
  1.4        70       -6.63                    K.LVELLLNSGSREQDVR.K
Top scoring peptide matches to query 1512
Elution from: 31.75 to 35.75 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2548097.6 FinneganScanNumber: 2116
Score greater than 19 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.6       8.4         554        R.AAELGHELSMEILAKAK.A
  5.8        26         552        R.KEPEIMKNIIGFYTK.G
  5.0        30         536        R.ARPQQDLARLVMEKR.Q
  3.3        45       -6.63        K.LVELLLNSGSREQDVR.K
  3.1        47        7.01        R.VIVTDTWVMKVTTYR.V
  3.0        49        0.87        K.LVISVHGGIQNFTMPSK.F
  2.6        53         569        R.GKQLTMYRVWIQCK.Y
  2.5        54         554        -.MELWAPQRLPQTRGK.A
  2.5        54       -8.84        R.GHYTIGKEIVDLVLDR.I
  2.5        55         560        K.MIHEGPLTWRISKDK.T
Top scoring peptide matches to query 1513
Elution from: 31.77 to 35.77 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2548097.6 FinneganScanNumber: 2117
Score greater than 17 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.3        18       -6.63        K.LVELLLNSGSREQDVR.K
  4.3        36        0.87        K.LVISVHGGIQNFTMPSK.F
  3.7        41         554        K.QPMDLSSVISKIDLHK.Y
  3.0        48         554        R.DLQLEIDQLKHSLMK.A
  3.0        49         554        K.VPPERVEKIMDQIEK.Y
  2.8        50         554        -.MELWAPQRLPQTRGK.A
  2.8        51        18.6        K.TYYMSGGLQPVPIVFR.G
  2.8        51         552        R.KEPEIMKNIIGFYTK.G
  2.7        52         554        R.AAELGHELSMEILAKAK.A
  2.6        52        4.92        R.SPSTASLTRTPPGTWLR.R
Top scoring peptide matches to query 1514
Elution from: 31.77 to 35.79 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1164620.2 FinneganScanNumber: 2120
Score greater than 30 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 35.7     0.026        1.60    1   IPI00301263 R.VLGTPVETIELTEDRR.A
 15.3       2.8       -7.12                    R.RRLPATTLGGACLQASR.G
  7.3        18       -5.26                    R.LEHAQARLTLSYNRR.G
  6.8        20      -19.04                    R.APFIEAAVAGLGAGSGKRR.R
  6.7        20       -7.49                    R.GVEVRFVHPEPGHVLR.T
  6.6        21         560                    R.LNRRDGAGGWSPLVSNK.Y
  5.3        28        11.3                    R.SILTQIDHILMDKER.L
  5.0        30      -10.69                    R.RVITSRIVGGEDAELGR.W
  4.3        35        10.6                    R.NLFAEIMKDHLANRR.K
  4.0        38        7.03                    R.LEFHNIETGIITERR.Y
Top scoring peptide matches to query 1515
Elution from: 31.73 to 35.73 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1164620.2 FinneganScanNumber: 2113
Score greater than 28 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 22.4      0.55       -5.26                    R.LEHAQARLTLSYNRR.G
 14.2       3.6        1.60    1   IPI00301263 R.VLGTPVETIELTEDRR.A
  7.2        18      -10.69                    R.RVITSRIVGGEDAELGR.W
  5.6        26         568                    R.VTNDISPESSPGVGRRR.T
  5.6        26         564                    R.SRSLTPQLNNNVPMQK.K
  5.1        29         564                    R.ICLERAEAGPLGVAGSAR.V
  4.8        32         530                    R.RSLIQFMKQVHQGVR.G
  4.0        38        2.98                    K.RCQYVTEKVLAAVYK.A
  4.0        38         534                    K.GVLQQGAGALGSSAQGVKAK.S
  3.3        45         560                    K.LTHDTVEQVRYRPGR.S
Top scoring peptide matches to query 1516
Elution from: 34.46 to 38.45 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 267220.6 FinneganScanNumber: 2368
Score greater than 21 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.7       5.6         548        R.QGTGRCSGASPCVSGAQR.A
  7.4        12        2.06        K.ETMSPAGGWVPMSSDLR.R
  7.3        12       -1.84        K.SSQMQSEPQKERNCK.L
  6.0        16        2.06        K.ETMSPAGGWVPMSSDLR.R
  2.8        34         529        R.MGLENESLLAGYTHER.I
  1.5        46         547        -.MSGGPGMGVEEPGATSLAR.H
  1.5        47        17.6        K.HAGFSCSSFVSDGPPER.T
  1.3        49         552        -.MGALGVSGSSSPGGCPGWR.R
  1.0        52      -12.99        K.GAEIEVDENGTLDLSMK.K
  0.7        56        18.0        R.METRGPQGAANPMDSSR.S
Top scoring peptide matches to query 1517
Elution from: 23.12 to 27.10 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 303110.3 FinneganScanNumber: 1338
Score greater than 15 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.7        14        5.72        R.SVWCRSPLSPGLIVLR.V
  6.5        14        18.0        K.NKAGGIMLPDIKLYYK.A
  2.5        35        3.90        K.VPMRITMDIKAPARPK.T
  2.0        39         557        M.VKPFTPSAGLLPEQAQR.H
  0.7        53        11.9        R.DLQQAALTKRAAQAAQR.E
  0.4        57         549        R.RHLENIMRISAILEK.N
  0.1        61         526        K.LLQEAEQRLKAIVAEK.F
Top scoring peptide matches to query 1518
Elution from: 41.82 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 410616.3 FinneganScanNumber: 3240
Score greater than 18 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  6.5        16         554        M.HSLATAAPVPTTLAQVDR.E
  6.1        18         539        R.LARALGNHQPLPYIER.F
  5.5        20       -4.83        R.LAQVGLVQTHTLTSAPGR.L
  4.8        24         540        K.VLPPSSTKPPALSHSTTK.S
  4.1        28       -0.92        K.SATIHAASKVFITFEVK.G
  4.0        28         534        R.MQKEIITLAPSTMKIK.I
  3.9        29         533        K.LGHGTIRQAKAGNHLFK.S
  3.6        31       -2.75        K.KVLDLGCGSGLLGITAFK.G
  3.4        33        12.3        R.SRAGPLRPQPLGMGAQGR.L
  2.6        40         555        K.IFTFAEKYLPALGYSK.R
Top scoring peptide matches to query 1519
Elution from: 41.62 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1697068.4 FinneganScanNumber: 3219
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1520
Elution from: 41.69 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 667544.9 FinneganScanNumber: 3228
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1521
Elution from: 41.56 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1838199.0 FinneganScanNumber: 3211
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1522
Elution from: 41.23 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 16879466.0 FinneganScanNumber: 3178
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1523
Elution from: 40.53 to 44.53 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4056346.1 FinneganScanNumber: 3116
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1524
Elution from: 41.18 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 20372232.0 FinneganScanNumber: 3174
Score greater than 18 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 11.1       4.5      -17.56        K.TQGGASNPALQIGSHPMCK.S
  5.2        17         500        R.GELDLSMTNLRGAEGSMR.G
  4.2        22         511        R.AANGSSERGGAVSTPDYGEK.K
  2.7        31      -15.15        K.EVSFDGNDLENMVLSLR.E
  2.5        32      -15.61        R.CCLGCGLLDGVFNVELK.L
  2.5        33        1.10        K.REKPSNEHTAEMEHMK.S
  2.0        36         526        K.EAAKWMDEAQSLDTADR.F
  2.0        36         515        R.LPRDSLGSSASSSSMDPDK.G
  1.8        38         520        K.CQPGFTGARCTENVPMK.V
  0.6        50         499        K.DSDALTLQKYAQQDDNK.I
Top scoring peptide matches to query 1525
Elution from: 41.18 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2812047.0 FinneganScanNumber: 3175
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1526
Elution from: 16.58 to 20.57 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 669182.4 FinneganScanNumber: 843
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.6       2.4      -16.09        GSGKSNMGTSGDHDDSFMK
Top scoring peptide matches to query 1527
Elution from: 16.48 to 20.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 669182.4 FinneganScanNumber: 834
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1528
Elution from: 16.48 to 20.48 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 669182.4 FinneganScanNumber: 835
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1529
Elution from: 40.98 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 220417.7 FinneganScanNumber: 3150
Score greater than 13 indicates homology
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.1       5.2        2.36        K.EFIDTMMSNTECFSEK.L
Top scoring peptide matches to query 1530
Elution from: 41.00 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 220417.7 FinneganScanNumber: 3153
Score greater than 14 indicates homology
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.4       3.8      -13.94        M.ATQADLMELDMAMEPDR.K
Top scoring peptide matches to query 1531
Elution from: 41.07 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1444177.0 FinneganScanNumber: 3163
Score greater than 16 indicates homology
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.1       1.7         504        K.EFIDTMMSNTECFSEK.L
  3.5       2.4        8.06        K.CMANEVMEDPGQGSSMAR.M
  3.4       2.5         487        R.QTPCNCSYPLVCDSQR.K
  2.5       3.1       -8.59        K.GEASCCDPVSAAFEGCLR.R
  2.4       3.2        8.06        K.CMANEVMEDPGQGSSMAR.M
  0.2       5.2         504        K.EFIDTMMSNTECFSEK.L
Top scoring peptide matches to query 1532
Elution from: 40.98 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1444177.0 FinneganScanNumber: 3150
Score greater than 13 indicates homology
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.8       3.6       -3.73        K.EIQSGSSSSDAEESSEDNK.K
  0.1       5.4         504        K.EFIDTMMSNTECFSEK.L
Top scoring peptide matches to query 1533
Elution from: 41.00 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1444177.0 FinneganScanNumber: 3153
Score greater than 13 indicates homology
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.4         4         488        M.ATQADLMELDMAMEPDR.K
  0.3       5.1        8.06        K.CMANEVMEDPGQGSSMAR.M
Top scoring peptide matches to query 1534
Elution from: 38.69 to 42.66 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 4604633.7 FinneganScanNumber: 2992
Score greater than 17 indicates homology
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.0       2.9        14.9        K.TNLKDVIGAGLQQLLASLR.A
  4.4       3.3        2.40        K.DKTGKPISKAVIVLNEGIK.V
  2.8       4.8       -1.95        K.FSIIVRLPPLIGQKICR.L
  0.5       8.2         515        K.ILQWLPTALRQQSVRVT.-
  0.2       8.8         515        K.LNTRLPGDVPPVKHPLQK.Y
Top scoring peptide matches to query 1535
Elution from: 41.60 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 226192.0 FinneganScanNumber: 3216
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1536
Elution from: 41.37 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 65283680.9 FinneganScanNumber: 3192
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1537
Elution from: 21.92 to 25.91 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 0.0 FinneganScanNumber: 1219
Score greater than 13 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.4        13         490        K.YTLTLLAQDQGLQPLSAKK.Q
  0.8        24         467        R.KIKHPTALGLEVGQEIQVK.Y
Top scoring peptide matches to query 1538
Elution from: 40.74 to 44.74 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 6950869.7 FinneganScanNumber: 3129
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1539
Elution from: 40.82 to 44.82 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2085496.9 FinneganScanNumber: 3135
Score greater than 15 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.2       1.3         446        -.MCAPADGPPTGEADGGCLEDR.G
Top scoring peptide matches to query 1540
Elution from: 40.55 to 44.55 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 806357.8 FinneganScanNumber: 3118
Score greater than 19 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.6       3.2         445        K.EEEKEEEEEEEEEKEEK.E
  0.3       4.3         443        K.CNICIEKNGGCNHMQCSK.C
Top scoring peptide matches to query 1541
Elution from: 33.31 to 37.30 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1298434.3 FinneganScanNumber: 2252
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 13.0       5.7         471        R.GTEEVFQALEDNQVALSTMK.A
 11.2       8.5         444        R.VNFGWGLKEFQLSSANGDIK.C
 11.0       9.1         473        -.XPIRKSTSMDSGSSESPASLK.R
 10.7       9.7        13.1        K.SWEEICRASEFPAFRGLR.Q
 10.6        10        10.1        R.HSNGSQFYITLQATPYLDR.K
  9.5        13         450        R.KGFAELQTDMTDLTKELNR.S
  9.0        14       -7.86        R.TWYVGKINRTQAEEMLSGK.R
  8.8        15         467        R.NREHNENLNAEMQNLKQK.F
  8.7        15       -6.34        K.EGEIIHLISKETGEAGWWR.G
  8.7        16         439        R.EQHLTEKILGWATGQNWAK.T
Top scoring peptide matches to query 1542
Elution from: 33.29 to 37.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1298434.3 FinneganScanNumber: 2248
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 22.6      0.62         450        R.KGFAELQTDMTDLTKELNR.S
 12.1         7        13.1        K.SWEEICRASEFPAFRGLR.Q
 11.9       7.3         471        K.ASEENLKAMATSQFHFNLR.T
  7.8        19        11.2        K.FSHCSFSQPVFPYLNPRK.C
  7.7        19       -7.86        R.TWYVGKINRTQAEEMLSGK.R
  7.4        21        10.1        R.HSNGSQFYITLQATPYLDR.K
  7.1        22       -6.34        K.EGEIIHLISKETGEAGWWR.G
  7.0        23         465        R.IRMEQLMSITQEETESLR.R
  6.4        26         470        R.KSALCCWQLICWAIRSAS.-
  6.0        29        15.2        R.TVNLTDFSNKWDSTNPFPK.D
Top scoring peptide matches to query 1543
Elution from: 33.26 to 37.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1298434.3 FinneganScanNumber: 2245
Score greater than 32 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 19.7       1.2       -7.86        R.TWYVGKINRTQAEEMLSGK.R
 18.0       1.8         450        R.KGFAELQTDMTDLTKELNR.S
 15.7         3         444        R.VNFGWGLKEFQLSSANGDIK.C
 14.6       3.9         469        K.DQDSRSAPEPKKPEENPASK.F
 14.3       4.3        15.2        R.TVNLTDFSNKWDSTNPFPK.D
 11.4       8.3        10.1        R.HSNGSQFYITLQATPYLDR.K
 10.0        11         436        K.ETHTKLALAEARVQEEEQK.A
  8.7        15        16.9        R.KSGSTGNICSVMLNVATGCVR.I
  7.9        18      -12.88        R.QLHGLLQARGSRDGGASSTGSR.D
  7.9        18        1.99        M.SPVAPLCMRSTSSGANYRLK.L
Top scoring peptide matches to query 1544
Elution from: 33.26 to 37.26 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1298434.3 FinneganScanNumber: 2246
Score greater than 25 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 15.9       2.9        15.2        R.TVNLTDFSNKWDSTNPFPK.D
 11.8       7.4       -0.97        R.TTSPQQEILLQSLEPGCPGR.H
 11.6       7.9      -12.88        R.QLHGLLQARGSRDGGASSTGSR.D
 11.4       8.2         471        R.GTEEVFQALEDNQVALSTMK.A
 11.2       8.6         450        R.KGFAELQTDMTDLTKELNR.S
 10.8       9.4         466        -.MSAAGAGAGVEAGFSSEELLSLR.F
 10.5        10         467        R.NREHNENLNAEMQNLKQK.F
 10.5        10        19.1        K.ASMKGLGTDEDSLIEIICSR.T
 10.1        11       -6.34        K.EGEIIHLISKETGEAGWWR.G
  9.7        12         466        -.MAKSPENSTLEEILGQYQR.S
Top scoring peptide matches to query 1545
Elution from: 33.31 to 37.30 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1529495.4 FinneganScanNumber: 2252
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.6       3.9         471        R.KSGSTGNICSVMLNVATGCVR.I
 12.8       5.9        10.4        K.TAEHHFTALPTDMKVEWAK.K
 12.8       5.9        2.32        K.CPESLRPETVRPCLLPCK.K
  9.2        14         456        K.ALYQTGVDNCGRTVMVVVGR.N
  9.2        14         464        R.HSNGSQFYITLQATPYLDR.K
  9.1        14        18.5        R.TVQGMAQGMAWTGQFTIWAK.W
  7.2        22         459        K.CGMVGGVHPEAAVRVVQSMAR.F
  6.1        28        2.74        K.MQEINNQKANHKIEELEK.A
  5.7        31         469        R.TVNLTDFSNKWDSTNPFPK.D
  4.5        41        7.11        K.TFWDLKEEFHKICMLAK.A
Top scoring peptide matches to query 1546
Elution from: 41.58 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 7968940.1 FinneganScanNumber: 3212
Score greater than 15 indicates homology
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.7       2.2        8.42        R.SNLPLALGLALVAFCLLALPR.D
  2.6       3.5        14.2        R.LRGRRPSPRPSPRPSPRPR.R
  1.2       4.8         463        R.GGRALLSLRPSAVRAGGAVLSGR.G
  0.2       6.1        15.3        R.LRPNIIPVLDEIKSMATAIK.E
Top scoring peptide matches to query 1547
Elution from: 33.51 to 37.51 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1282922.4 FinneganScanNumber: 2274
Score greater than 26 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.8       2.5         460        R.DFPELTMEVDGKVESIMKR.T
 12.0       7.5         452        R.GVSAIVYMVDAADQEKIEASK.N
 11.3       8.9      -12.20        R.DKGNLSIPAKAPNSDMPDLLL.-
  8.6        17       -7.75        R.KLMLDTWNESIFSNIKNR.L
  8.3        18        10.4        K.YAELKDRLGQSSMLGEQGAR.I
  7.9        19         458        K.HVDSMAELTEHVESLQRVK.S
  6.5        27        15.1        R.IEHEHEGCLKMSPASLMKK.-
  5.6        33        12.1        K.DSEGIDIMLGVCANGLLIYR.D
  5.0        37         469        R.RPLEAGSPGQDLEPACDGARK.V
  4.3        44         444        M.AFPHRPDAPELPDFSMLKR.L
Top scoring peptide matches to query 1548
Elution from: 33.49 to 37.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1282922.4 FinneganScanNumber: 2270
Score greater than 20 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 10.7        10        15.1        R.IEHEHEGCLKMSPASLMKK.-
  6.7        25         452        R.GVSAIVYMVDAADQEKIEASK.N
  5.7        32        18.4        R.NGSMKVQISSQNPPPSPMPGR.I
  5.5        34      -11.00        -.MKPQVETGEAARDPSLRPAR.T
  5.5        34         433        K.NICEDGRKFISYFILVHL.-
  4.6        42         465        R.QKAENFWTGDTSSDQLVLGK.K
  4.2        45       -7.78        R.FPSLHVVKVLLDCGADPDSR.D
  3.4        54       -4.43        K.QQLLSYELGQGHAQASPEIR.F
  3.2        57        4.15        K.KNGQLAASVETAGDSELFLMK.L
  3.2        57         456        K.TQEGDILLFCKGADSAVFPR.V
Top scoring peptide matches to query 1549
Elution from: 33.49 to 37.49 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1282922.4 FinneganScanNumber: 2269
Score greater than 27 indicates homology
Score greater than 33 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 16.3       2.8        16.9        R.SITDKTSGGPSSGGGFVDWTLR.L
 13.8         5       -7.75        R.KLMLDTWNESIFSNIKNR.L
 13.2       5.7        10.4        R.FTSTKLAQMERENQQLER.E
  7.0        24        17.0        R.GTVTDFPGFDERADAETLRK.A
  5.1        37        12.1        K.DSEGIDIMLGVCANGLLIYR.D
  5.1        37         445        R.AALVNMGDLTTYDTVKHYLV.-
  5.0        37       -5.95        R.LAGASPATVAAAAAAGSGPKDPMAR.K
  5.0        37         443        R.CAAGAASGSPARELAPRLAGGAGR.S
  4.7        40       -0.97        R.ELFQEMAIDIIPPYMIAAK.E
  4.5        43        13.1        R.KFPREGFGEDMRPFNELR.V
Top scoring peptide matches to query 1550
Elution from: 40.60 to 44.59 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 5710006.5 FinneganScanNumber: 3121
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1551
Elution from: 40.26 to 44.25 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2405036.7 FinneganScanNumber: 3098
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  9.9       5.5      -13.09        R.SSPEADLTMEKITVESDHFR.V
  8.9       6.8        4.34        K.SEVEEWSDMYTVTSQLMLK.V
  7.8       8.8         423        K.SQIMLDMLTENLFFDTGMGK.S
  7.5       9.6         420        R.TDWSLSDVDQWDTAALADGIK.S
  7.0        11       -0.44        R.AMSQDSNSNAAPGKSPGDLTTSR.T
  6.4        12         436        K.KTMSTDEGTYMCIAENRVGK.M
  6.3        13         418        R.LGDDYNIPHWINHSFYTSK.S
  6.0        13         421        M.GHLACFSGGMIALGAEDAKEEK.R
  5.7        14         420        K.CQNYLAESKPSGREDPGSGVR.V
  5.5        15        17.4        K.NEAEGADDLQANEEDSSSSLVK.D
Top scoring peptide matches to query 1552
Elution from: 37.09 to 41.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 368166.0 FinneganScanNumber: 2779
Score greater than 14 indicates homology
Score greater than 22 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.7         6        14.4        R.SLPGVNRATLAAIIEHLYRVQK.C
Top scoring peptide matches to query 1553
Elution from: 41.86 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 3490426.0 FinneganScanNumber: 3243
Score greater than 14 indicates homology
Score greater than 27 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.9       4.3         413        K.QTIEILMNPILLVKNTSLSMSK.D
  0.8        22        19.7        K.TIGLGLGILIWGSFNALTGWASSR.F
  0.7        23         402        R.AAAQKPHHLHPHILLAGSAAVPPR.V
  0.6        24         415        R.NVMTALQFPKIMEFLPVLLPR.H
Top scoring peptide matches to query 1554
Elution from: 22.02 to 26.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 431661.1 FinneganScanNumber: 1231
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1555
Elution from: 22.00 to 26.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 431661.1 FinneganScanNumber: 1229
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.3       1.5       -7.96        R.DPCDPNPCQNDGICVNVKGMASCR.C
  0.9       2.6         366        K.KGLSPHCNGSDCGYSSSMEGSETGSR.E
  0.5       2.9         343        R.VMFENEQMVMPGDPVEMTEFQDK.A
Top scoring peptide matches to query 1556
Elution from: 22.00 to 26.01 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 431661.1 FinneganScanNumber: 1230
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1557
Elution from: 22.06 to 26.05 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 482068.5 FinneganScanNumber: 1234
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1558
Elution from: 22.14 to 26.13 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 482068.5 FinneganScanNumber: 1241
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.0       3.9       -7.35        R.CSSMCTASXLCRVNSSPHSEQMR.F
Top scoring peptide matches to query 1559
Elution from: 22.18 to 26.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 482068.5 FinneganScanNumber: 1244
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1560
Elution from: 22.22 to 26.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 300989.6 FinneganScanNumber: 1248
Score greater than 19 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.6       1.7      -11.91        -.MSHGHSHGGGGCRCAAEREEPPEQR.G
  4.0       1.9         341        K.SLFPQGMGRGQKDXMCPPSCCVGR.S
  3.4       2.2         340        -.MEVAMVSAESSGCNSHMPYGYAAQAR.A
  1.1       3.7       -4.84        M.STMGNEASYPAEMCSHFDNDEIKR.L
  0.1       4.7       -8.86        R.CFPCYRESGKSNVGTSGDHDDSAMK.T
  0.1       4.7         349        R.MCQATGTQGYPCEGTGEEVKPCSEK.R
Top scoring peptide matches to query 1561
Elution from: 22.28 to 26.27 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 300989.6 FinneganScanNumber: 1252
Score greater than 19 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.2       1.5       -4.84        M.STMGNEASYPAEMCSHFDNDEIKR.L
  1.1       3.8        7.54        R.DSSSDSSSESDSSDERVEFDPQQER.D
  0.2       4.6       -8.86        R.CFPCYRESGKSNVGTSGDHDDSAMK.T
  0.1       4.7         359        K.VACFETEDGEYSVCQRSYSNCSR.L
Top scoring peptide matches to query 1562
Elution from: 22.28 to 26.29 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 300989.6 FinneganScanNumber: 1255
Score greater than 19 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  3.4       2.2         341        K.SLFPQGMGRGQKDXMCPPSCCVGR.S
  2.9       2.5      -12.70        R.CVCKMPYECGPSLDVCAQDERSK.R
  2.6       2.7      -19.27        R.CFSNYSMVNTTNMTSAVVEFWER.N
  0.7       4.1        7.54        R.DSSSDSSSESDSSDERVEFDPQQER.D
  0.6       4.3      -19.20        R.NSGAGYGCPHGDPSMLDSRETPQESR.Q
  0.5       4.3         359        K.VACFETEDGEYSVCQRSYSNCSR.L
  0.5       4.3      -14.53        -.MARCRHHSGYLADDEASHSMCSAR.V
  0.5       4.4         340        R.SGAQQLEEEGPMEEEEAQPMAAPEGK.R
  0.4       4.5         354        R.NSECKKEVDFSMYHPDDEADEMK.S
Top scoring peptide matches to query 1563
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2089697.3 FinneganScanNumber: 3086
Score greater than 25 indicates homology
Score greater than 32 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
 14.6       3.3         370        K.AVLSIDYYNMFTSIFTLTMMSVDR.Y
 14.6       3.3         370        K.AVLSIDYYNMFTSIFTLTMMSVDR.Y
 11.4       6.8         352        R.SLEAGPRHAGSVKPEASEAFPGAWENR.T
  9.1        12         354        K.SLMSISNAGSGLLSHSSTLTGSPIMEEK.R
  9.1        12         359        R.IKLNQPASLYCPHMVSWEEYASAR.G
  9.0        12         343        -.MGNLTMTTASPDLIRGQSSSKVPMAEK.V
  8.8        13         339        K.FVEQNETAINITTYPDQENNKLLR.G
  8.4        14         366        K.FNISNCCLNIGNNGEEVLEIASNIR.K
  8.1        15         366        R.GARGAQRGGSPDSAHGSRPAEAGVSAQCR.E
  7.5        17        9.29        M.SMNNSKQLVSPAAALLSNTTCQTENR.L
Top scoring peptide matches to query 1564
Elution from: 40.18 to 44.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 459166.0 FinneganScanNumber: 3089
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.8       1.9         365        -.MAAVALMPPPLLLLLLLASPPAASAPSAR.D
  1.9       2.3        12.0        R.VPGPVHLRGRSPTPALDPLAPLNPLIR.G
  1.9       2.3        9.90        K.GSLDIIILIFVLSAVVPDKMQKAINR.L
  0.7       3.1         370        R.YVLYVTGYLLLKPCPETIKSLLIR.R
  0.5       3.2        12.5        R.VLPSIVNEVLKSVVAKFNASQLITQR.A
Top scoring peptide matches to query 1565
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 459166.0 FinneganScanNumber: 3086
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.1       1.1         357        R.VKGSRLVKPSLCLALLCPAFLVGVVR.V
  4.1       1.4        7.12        R.QNLVALTVTTLLGVAVGGFVLWKGIQR.R
  2.6         2        12.0        R.VPGPVHLRGRSPTPALDPLAPLNPLIR.G
  1.8       2.4        9.90        K.GSLDIIILIFVLSAVVPDKMQKAINR.L
  0.4       3.3        13.5        K.RMILIYLLPVKMLLGHMPTVELLK.K
Top scoring peptide matches to query 1566
Elution from: 40.18 to 44.19 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 98249.0 FinneganScanNumber: 3089
Score greater than 15 indicates homology
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.6       2.7        8.65        K.AMKLLLLYGAELGVRNAASVTPVQLAR.D
  2.0       4.8        18.8        K.MAKSHVFLSGMGGLGLEIAKNLVLAGIK.A
  1.9       4.9         351        R.VPGPVHLRGRSPTPALDPLAPLNPLIR.G
  1.9       4.9        17.7        K.DLIYGPVLPLSAIAGLVGKEAETFRPK.D
  1.9       4.9         349        K.GSLDIIILIFVLSAVVPDKMQKAINR.L
  1.6       5.3        3.30        M.VLLLLVAIPLLVHSSRGPAHYEMLGR.C
  1.4       5.5        18.6        K.FLIWLSDLLLMRKALFEPLHPASK.R
  0.5       6.9         351        R.VLPSIVNEVLKSVVAKFNASQLITQR.A
  0.4       6.9         365        R.TRIQVFWIAPPAGTGCVILKASIVQK.R
  0.1       7.4        10.3        R.ELLPVKKFESEILEAISQNSVVIIR.G
Top scoring peptide matches to query 1567
Elution from: 21.86 to 25.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1177560.8 FinneganScanNumber: 1211
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1568
Elution from: 21.78 to 25.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1177560.8 FinneganScanNumber: 1200
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.6       2.9         330        R.GYYNQSEDGSHTIQIMYGCDVGSDGR.F
  0.0       3.3         324        R.CSGGMRLTATYRYILSCHCEECNS.-
Top scoring peptide matches to query 1569
Elution from: 21.78 to 25.76 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1177560.8 FinneganScanNumber: 1199
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.7      0.56         336        R.GYYNQSEAGSHTIQMMYGCDVGPDGR.L
Top scoring peptide matches to query 1570
Elution from: 21.78 to 25.78 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1177560.8 FinneganScanNumber: 1201
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1571
Elution from: 22.06 to 26.05 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 707508.7 FinneganScanNumber: 1235
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1572
Elution from: 21.96 to 25.95 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 707508.7 FinneganScanNumber: 1223
Score greater than 15 indicates homology
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.3       2.5         332        R.SMMSPMAERSMMSAYERSMMSAYER.S
  4.3       2.5         332        R.SMMSPMAERSMMSAYERSMMSAYER.S
  2.6       3.8         323        R.SDMFTWDPYGPWEGCTKMCQGLQR.R
  1.5       4.9         332        R.SMMSAYERSMMSPMAERSMMSAYER.S
  1.5       4.9         332        R.SMMSAYERSMMSPMAERSMMSAYER.S
Top scoring peptide matches to query 1573
Elution from: 21.98 to 25.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 707508.7 FinneganScanNumber: 1226
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1574
Elution from: 21.96 to 25.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 707508.7 FinneganScanNumber: 1225
Score greater than 13 indicates homology
Score greater than 21 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.1       2.7         332        R.SMMSAYERSMMSPMAERSMMSAYER.S
  0.1       6.7         322        K.EEEDKDDEEKPKIEDVGSDEEDDSGK.D
Top scoring peptide matches to query 1575
Elution from: 22.18 to 26.18 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 257984.3 FinneganScanNumber: 1245
Score greater than 20 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1576
Elution from: 41.58 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 361467.1 FinneganScanNumber: 3214
Score greater than 17 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  4.8        23         335        K.LMGCDSFDQFSAERRNSILTETLHR.F
  4.6        24         325        K.ELTIVGMTFTTFDLGQHEQACRVWK.N
  4.1        27         343        R.FLLFCVHGDARQDSLVQWEMEVCK.L
  4.0        27         326        K.ERLLSNGWETASAVDMMELYNRLPR.A
  4.0        27         318        K.GWLTWLXRLRSPGVCSQQAGDPGQPMI.-
  3.8        29        3.56        R.THTGEKPYECQECAKAFISLPSFQR.H
  3.1        34         325        R.IHTGEKPYECKECGKAFIHSSYLTK.H
  3.1        34        3.63        K.QQVEGTAQEAGEDSARPRAQAGAPAWMR.R
  3.1        34        9.40        K.GEGLQENESSTLKSSLVTVTDWSDTSDV.-
  3.0        35         331        K.EATSVYHDMSIDSPMKLESLTDIIQK.K
Top scoring peptide matches to query 1577
Elution from: 41.58 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 796784.2 FinneganScanNumber: 3213
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1578
Elution from: 21.88 to 25.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1371421.9 FinneganScanNumber: 1212
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.0       2.2       -9.68        R.HWHMDHFCCFECEASLGGQRYVMR.Q
  1.6       2.4         336        K.ENDQEHDESDNEVMGKSEESDTDTSER.Q
Top scoring peptide matches to query 1579
Elution from: 21.82 to 25.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1371421.9 FinneganScanNumber: 1207
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.1       2.7         306        R.AWALFPPSDDYDDTDDDDPFNPQQESK.R
Top scoring peptide matches to query 1580
Elution from: 21.86 to 25.87 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1371421.9 FinneganScanNumber: 1210
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1581
Elution from: 21.80 to 25.81 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 1371421.9 FinneganScanNumber: 1203
Score greater than 18 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1582
Elution from: 40.23 to 44.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 167005.0 FinneganScanNumber: 3092
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1583
Elution from: 40.23 to 44.21 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 292170.9 FinneganScanNumber: 3093
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1584
Elution from: 22.85 to 26.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 379858.3 FinneganScanNumber: 1314
Score greater than 14 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.9       0.9         300        R.ENIWKMQGLMFRCSTSCCEDSQASMQ.-
Top scoring peptide matches to query 1585
Elution from: 22.81 to 26.80 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 387606.6 FinneganScanNumber: 1310
Score greater than 14 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  1.7      0.95       -2.60        R.QDGDEEFEEEEEESENKSMDTDPETIR.D
Top scoring peptide matches to query 1586
Elution from: 22.85 to 26.83 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 379858.3 FinneganScanNumber: 1315
Score greater than 14 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.8       1.2       -2.60        R.QDGDEEFEEEEEESENKSMDTDPETIR.D
Top scoring peptide matches to query 1587
Elution from: 41.69 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 416048.9 FinneganScanNumber: 3229
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1588
Elution from: 41.69 to 44.98 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 384940.1 FinneganScanNumber: 3230
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1589
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 84896.5 FinneganScanNumber: 3086
Score greater than 17 indicates homology
Score greater than 25 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  5.5       5.5        10.8        K.NYWLVTVLHDRQINLNELAKQLGVGSGNLR.F
  4.4       7.1        10.2        K.IDIIPNPQERTLALVDTGIGMTKADLINNLR.T
  4.1       7.6        4.53        K.DHGSGELVMGFSVALSLLGEILLHPFKATLLR.K
  4.1       7.6        16.8        K.EILLSNAHIPSVASEIVENMLEKLESAVEKK.C
  4.0       7.7         295        R.LSAEEAHLGILGPVIKAEVGDTLLVTFANKADK.V
  3.8       8.2         299        K.KKPVVVSGPYIVYMLQDLDILEDWTTIRK.A
  3.5       8.7        12.9        K.SRSSPFPTVPTRPEKGYIWTHVGPTPAITIK.E
  3.2       9.2         305        K.LEKFRPLQLETINVTMAGKEVFLVMPTGGGK.S
  3.0       9.8      -13.07        K.AAVPPLPPGPLLPQAGMRPGARLGLGPGPWRAPR.H
  2.4        11         310        K.LSQSEENISGMTSFREVLEKMLVIVVLPVR.N
Top scoring peptide matches to query 1590
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 308449.5 FinneganScanNumber: 3086
Score greater than 20 indicates homology
Score greater than 31 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  8.2        12      -13.62        K.DIPDPGPPGDQGPPGPDGPRGAPGPPGLPGSVDLLR.G
  7.2        15       -7.42        K.AEIHGGSLINLTWTAPGDDYDHGTAHKYIIR.I
  6.9        16         291        R.DDAVVNKGSDESIGKGDGFDFLPQLNSVFPPR.K
  6.1        19         280        M.NSVPKAESPACVPEASSTPASLWSPVSTIPTPR.W
  4.9        25       -5.52        R.HPSHVQLKVVAGNHDIGFHYEMNTYKVER.F
  4.9        25      -14.99        K.IAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFR.G
  4.7        27         290        K.WDQFYSEVLGRPTTLFETMGKAEMWLIR.T
  4.5        28       -3.22        R.SQSQSDMKTIRFPFGSEFRPLGPCPALSHK.A
  4.4        29        10.5        R.AVVACFRMTPLYNLPTHRACNMFLESYK.A
  4.0        31         309        R.LSDITSSNMQICGFKSTVPHFTEEEKYQK.L
Top scoring peptide matches to query 1591
Elution from: 22.97 to 26.97 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 474323.1 FinneganScanNumber: 1327
Score greater than 15 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1592
Elution from: 22.99 to 26.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 474323.1 FinneganScanNumber: 1329
Score greater than 15 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
Top scoring peptide matches to query 1593
Elution from: 22.99 to 26.99 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 699763.8 FinneganScanNumber: 1329
Score greater than 14 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.1       1.3         308        K.VNPECDDQEDCSDGSDEAHCECGLQPAWR.M
Top scoring peptide matches to query 1594
Elution from: 24.08 to 28.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 308034.4 FinneganScanNumber: 1410
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.7         1      -16.24        K.TKNSYWQCSECDQAGSSDMEADMAMETLPDGTK.R
Top scoring peptide matches to query 1595
Elution from: 24.06 to 28.07 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 308034.4 FinneganScanNumber: 1404
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.1       1.2        15.5        R.KECSSTSNAECDCTPGFHCLGAGCSMCEQDCK.Q
Top scoring peptide matches to query 1596
Elution from: 24.08 to 28.09 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 498558.6 FinneganScanNumber: 1410
Score greater than 13 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  0.6         1         252        K.TKNSYWQCSECDQAGSSDMEADMAMETLPDGTK.R
Top scoring peptide matches to query 1597
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 114572.7 FinneganScanNumber: 3086
Score greater than 22 indicates homology
Score greater than 30 indicates identity
Score    Expect        ppm   Hit  Protein      Peptide
 12.8         3      -15.09                    M.SSSELLSKPLTVVYKSLHDLSCYIFHSRSRPDLR.G
  8.9       7.3         245                    K.ENHATFMSELKNLQASGLTTLGQALRSSFDLLNLNR.L
  7.3        11        4.99                    R.ELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAAR.T
  6.6        12        8.91                    R.WNTEFLYTLHPVSPFINILYSYGWNGRMHVHAK.H
  6.3        13        7.38                    R.QMQALGIAMXSVHGWVQERMPISLIDPIHPFKPR.D
  5.7        15       -2.98    8   IPI00024067 R.EKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASK.V
  5.3        17       -2.83                    R.VLADPEIPVQVTQDIEPHLGALFTQMLEVGTTEDLR.L
  5.0        18        0.03                    R.SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTSQVTRGR.K
  4.9        18      -11.32                    R.LMLGVGLIEKDTNGEVLWVWCYPSTTATLXNLLLR.K
  4.9        18         235                    R.LMLGVGLIEKDTNGEVLWVWCYPSTTATLXNLLLR.K
Top scoring peptide matches to query 1598
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 103021.5 FinneganScanNumber: 3086
Score greater than 19 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  2.6       2.2       -0.94        K.IPIGTEIEGMNILGLVLFALVLGVALKKLGSEGEDLIR.F
  2.1       2.6        18.8        K.GWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLR.L
  2.0       2.6        9.65        -.MVYIVRQFLLYNVSGSVYLDQLIVLLTAKFSILR.I
  0.2       3.9        19.7        R.SKSTEFYSELWFIVLMAMLGLILLAIFLSLILQR.K
Top scoring peptide matches to query 1599
Elution from: 40.18 to 44.16 period: MMuqit_081119_01.raw experiment: 1 cycles: 1 precIntensity: 2093791.6 FinneganScanNumber: 3086
Score greater than 19 indicates homology
Score greater than 26 indicates identity
Score    Expect        ppm   Hit  Protein Peptide
  7.4       3.9        4.15        K.SLYLETLHALEDLLTSLLQRNMTPQGLQIMIEHLSPWIK.S
  6.3         5        17.6        -.MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPK.L
  4.7       7.4         232        MNSTTTTAVSASSTSSSAVSTPPLIKPVLMSKSVPPSPEKILNGK
  3.5       9.6        19.6        R.CEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQK.L
  3.3        10         237        R.VTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVK.V
  3.3        10        14.6        R.QLVANLELMANWYNKVMKTLLEVEFPLVEEELQNIDLR.L
  3.3        10        14.6        R.QLVANLELMANWYNKVMKTLLEVEFPLVEEELQNIDLR.L
  3.0        11        4.15        K.SLYLETLHALEDLLTSLLQRNMTPQGLQIMIEHLSPWIK.S
  2.9        11        2.28        R.YADLLIYTYVGDILIALNPFQNLSIYSPQFSRLYHGVKR.A
  2.5        12         216        -.MRPSPPGWLLYLRIHRLSTGLTTRPTWPRPVWWMTLR.N